Details of Protein

General Information of Protein (ID: PRT00961)
Name Vitamin D3 receptor (VDR)
Synonyms   Click to Show/Hide Synonyms of This Protein
VDR; 1,25-dihydroxyvitamin D3 receptor; Nuclear receptor subfamily 1 group I member 1; VDR; NR1I1
Gene Name VDR Gene ID
7421
UniProt ID
P11473
Family Vitamin D receptor (VDR)
TC Number   TC: 9.B.208.1.1  (Click to Show/Hide the Complete TC Tree)
The Vitamin D3 Receptor (VDR) Family
.
TC: 9.B.208.1.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG
DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS
Structure
1DB1 ; 1IE8 ; 1IE9 ; 1KB2 ; 1KB4 ; 1KB6 ; 1S0Z ; 1S19 ; 1TXI ; 1YNW ; 2HAM ; 2HAR ; 2HAS ; 2HB7 ; 2HB8 ; 3A2I ; 3A2J ; 3A3Z ; 3A40 ; 3A78 ; 3AUQ ; 3AUR ; 3AX8 ; 3AZ1 ; 3AZ2 ; 3AZ3 ; 3B0T ; 3CS4 ; 3CS6 ; 3KPZ ; 3M7R ; 3OGT ; 3P8X ; 3TKC ; 3VHW ; 3W0A ; 3W0C ; 3W0Y ; 3WGP ; 3WWR ; 3X31 ; 3X36 ; 4G2I ; 4ITE ; 4ITF ; 5GT4 ; 5V39 ; 5YSY ; 5YT2
Function Nuclear receptor for calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells. Enters the nucleus upon vitamin D3 binding where it forms heterodimers with the retinoid X receptor/RXR. The VDR-RXR heterodimers bind to specific response elements on DNA and activate the transcription of vitamin D3-responsive target genes. Plays a central role in calcium homeostasis.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Galactonic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of VDR
                      Induced Change Galactonic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of VDR leads to the decrease of galactonic acid levels compared with control group.
      Organic oxygen compounds
            Aspartylglycosamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of VDR
                      Induced Change Aspartylglycosamine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of VDR leads to the decrease of aspartylglycosamine levels compared with control group.
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of VDR
                      Induced Change Glucose concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of VDR leads to the decrease of glucose levels compared with control group.
            N-Acetylmuramate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of VDR
                      Induced Change N-Acetylmuramate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of VDR leads to the increase of N-acetylmuramate levels compared with control group.
References
1 Vitamin D receptor promotes healthy microbial metabolites and microbiome. Sci Rep. 2020 Apr 30;10(1):7340.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.