Details of Protein

General Information of Protein (ID: PRT00895)
Name Histone-lysine N-methyltransferase EHMT2 (EHMT2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Euchromatic histone-lysine N-methyltransferase 2; HLA-B-associated transcript 8; Histone H3-K9 methyltransferase 3; H3-K9-HMTase 3; Lysine N-methyltransferase 1C; Protein G9a; EHMT2; BAT8; C6orf30; G9A; KMT1C; NG36
Gene Name EHMT2 Gene ID
10919
UniProt ID
Q96KQ7
Family Transferases (EC 2)
EC Number   EC: 2.1.1.-  (Click to Show/Hide the Complete EC Tree)
Transferase
Methylase
Methyltransferase
EC: 2.1.1.-
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAAAAGAAAAAAAEGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLE
PAGPSSPASVTVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSP
SKGGSCPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKV
HRARKTMSKPGNGQPPVPEKRPPEIQHFRMSDDVHSLGKVTSDLAKRRKLNSGGGLSEEL
GSARRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVDERVDSDSKSEVEALTEQLSE
EEEEEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRR
KREPPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGF
EELPLCSCRMEAPKIDRISERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVL
CETHRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDA
SEAQEVTIPRGDGVTPPAGTAAPAPPPLSQDVPGRADTSQPSARMRGHGEPRRPPCDPLA
DTIDSSGPSLTLPNGGCLSAVGLPLGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQ
GELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRT
PLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNA
QDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNA
RCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFA
LQLNRKLRLGVGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETS
TMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQA
CSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVR
EDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFS
SRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLP
ELGSLPPVNT
Structure
2O8J ; 3DM1 ; 3K5K ; 3RJW ; 4NVQ ; 5JHN ; 5JIN ; 5JIY ; 5JJ0 ; 5T0K ; 5T0M ; 5TTF ; 5TUY ; 5V9I ; 5VSC ; 5VSE ; 6MM1 ; 7BTV ; 7BUC
Function Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also mediates monomethylation of 'Lys-56' of histone H3 (H3K56me1) in G1 phase, leading to promote interaction between histone H3 and PCNA and regulating DNA replication. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. May also methylate histone H1. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Also methylates CDYL, WIZ, ACIN1, DNMT1, HDAC1, ERCC6, KLF12 and itself.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Glycine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (BIX01294 (BIX)) of EHMT2
                      Induced Change Glycine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Bone metastasis [ICD-11: 2E03]
                      Details It is reported that inhibition of EHMT2 leads to the decrease of glycine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of EHMT2
                      Induced Change Glycine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Bone metastasis [ICD-11: 2E03]
                      Details It is reported that overexpression of EHMT2 leads to the increase of glycine levels compared with control group.
            Phosphoserine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (BIX01294 (BIX)) of EHMT2
                      Induced Change Phosphoserine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Bone metastasis [ICD-11: 2E03]
                      Details It is reported that inhibition of EHMT2 leads to the decrease of phosphoserine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of EHMT2
                      Induced Change Phosphoserine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Bone metastasis [ICD-11: 2E03]
                      Details It is reported that overexpression of EHMT2 leads to the increase of phosphoserine levels compared with control group.
            Serine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (BIX01294 (BIX)) of EHMT2
                      Induced Change Serine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Bone metastasis [ICD-11: 2E03]
                      Details It is reported that inhibition of EHMT2 leads to the decrease of serine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of EHMT2
                      Induced Change Serine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Bone metastasis [ICD-11: 2E03]
                      Details It is reported that overexpression of EHMT2 leads to the increase of serine levels compared with control group.
References
1 The histone H3 methyltransferase G9A epigenetically activates the serine-glycine synthesis pathway to sustain cancer cell survival and proliferation. Cell Metab. 2013 Dec 3;18(6):896-907.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.