Details of Protein

General Information of Protein (ID: PRT00850)
Name Oxoglutarate/malate carrier protein (SLC25A11)
Synonyms   Click to Show/Hide Synonyms of This Protein
OGCP; Solute carrier family 25 member 11; SLC25A11; SLC20A4
Gene Name SLC25A11 Gene ID
8402
UniProt ID
Q02978
Family Mitochondrial carrier (MC)
TC Number   TC: 2.A.29.2.13  (Click to Show/Hide the Complete TC Tree)
The Mitochondrial Carrier (MC) Family
.
TC: 2.A.29.2.13
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTRE
YKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL
LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTL
WRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV
DIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL
EQMNKAYKRLFLSG
Function Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism. Maintains mitochondrial fusion and fission events, and the organization and morphology of cristae. Involved in the regulation of apoptosis. Acts as a tumor-suppressor gene implicated in the predisposition to metastatic paraganglioma.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            ATP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of SLC25A11
                      Induced Change ATP concentration: decrease (FC = 0.25)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Melanoma [ICD-11: 2C30]
                      Details It is reported that knockdown of SLC25A11 leads to the decrease of ATP levels compared with control group.
            NAD Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of SLC25A11
                      Induced Change NAD concentration: decrease (FC = 0.60)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Melanoma [ICD-11: 2C30]
                      Details It is reported that knockdown of SLC25A11 leads to the decrease of NAD levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of SLC25A11
                      Induced Change NAD concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Melanoma [ICD-11: 2C30]
                      Details It is reported that knockdown of SLC25A11 leads to the decrease of NAD levels compared with control group.
      Organic acids and derivatives
            Malic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of SLC25A11
                      Induced Change Malic acid concentration: decrease (FC = 0.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Melanoma [ICD-11: 2C30]
                      Details It is reported that knockdown of SLC25A11 leads to the decrease of malic acid levels compared with control group.
References
1 Loss of SLC25A11 causes suppression of NSCLC and melanoma tumor formation. EBioMedicine. 2019 Feb;40:184-197.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.