Details of Protein
| General Information of Protein (ID: PRT00850) | |||||
|---|---|---|---|---|---|
| Name | Oxoglutarate/malate carrier protein (SLC25A11) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
OGCP; Solute carrier family 25 member 11; SLC25A11; SLC20A4
|
||||
| Gene Name | SLC25A11 | Gene ID | |||
| UniProt ID | |||||
| Family | Mitochondrial carrier (MC) | ||||
| TC Number | TC: 2.A.29.2.13 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTRE
YKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTL WRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV DIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL EQMNKAYKRLFLSG |
||||
| Function | Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism. Maintains mitochondrial fusion and fission events, and the organization and morphology of cristae. Involved in the regulation of apoptosis. Acts as a tumor-suppressor gene implicated in the predisposition to metastatic paraganglioma. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Nucleosides, nucleotides, and analogues | ||||||
| ATP | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (siRNA) of SLC25A11 | |||||
| Induced Change | ATP concentration: decrease (FC = 0.25) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Melanoma [ICD-11: 2C30] | |||||
| Details | It is reported that knockdown of SLC25A11 leads to the decrease of ATP levels compared with control group. | |||||
| NAD | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (siRNA) of SLC25A11 | |||||
| Induced Change | NAD concentration: decrease (FC = 0.60) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Melanoma [ICD-11: 2C30] | |||||
| Details | It is reported that knockdown of SLC25A11 leads to the decrease of NAD levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (shRNA) of SLC25A11 | |||||
| Induced Change | NAD concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Melanoma [ICD-11: 2C30] | |||||
| Details | It is reported that knockdown of SLC25A11 leads to the decrease of NAD levels compared with control group. | |||||
| Organic acids and derivatives | ||||||
| Malic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (shRNA) of SLC25A11 | |||||
| Induced Change | Malic acid concentration: decrease (FC = 0.50) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Melanoma [ICD-11: 2C30] | |||||
| Details | It is reported that knockdown of SLC25A11 leads to the decrease of malic acid levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Loss of SLC25A11 causes suppression of NSCLC and melanoma tumor formation. EBioMedicine. 2019 Feb;40:184-197. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

