Details of Protein

General Information of Protein (ID: PRT00849)
Name Glutamate carrier 1 (SLC25A22)
Synonyms   Click to Show/Hide Synonyms of This Protein
GC-1; Glutamate/H(+) symporter 1; Solute carrier family 25 member 22; SLC25A22; GC1
Gene Name SLC25A22 Gene ID
79751
UniProt ID
Q9H936
Family Mitochondrial carrier (MC)
TC Number   TC: 2.A.29.14.3  (Click to Show/Hide the Complete TC Tree)
The Mitochondrial Carrier (MC) Family
.
TC: 2.A.29.14.3
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRVYTSMSDCLIKTVRSE
GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
TTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS
RGIAGLYKGLGATLLRDVPFSVVYFPLFANLNQLGRPASEEKSPFYVSFLAGCVAGSAAA
VAVNPCDVVKTRLQSLQRGVNEDTYSGILDCARKILRHEGPSAFLKGAYCRALVIAPLFG
IAQVVYFLGIAESLLGLLQDPQA
Function Involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H(+).
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Asparagine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of SLC25A22
                      Induced Change Asparagine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that knockdown of SLC25A22 leads to the decrease of asparagine levels compared with control group.
            Aspartic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of SLC25A22
                      Induced Change Aspartic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that knockdown of SLC25A22 leads to the decrease of aspartic acid levels compared with control group.
            Oxalacetic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of SLC25A22
                      Induced Change Oxalacetic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that knockdown of SLC25A22 leads to the decrease of oxalacetic acid levels compared with control group.
References
1 SLC25A22 Promotes Proliferation and Survival of Colorectal Cancer Cells With KRAS Mutations and Xenograft Tumor Progression in Mice via Intracellular Synthesis of Aspartate. Gastroenterology. 2016 Nov;151(5):945-960.e6.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.