Details of Protein
General Information of Protein (ID: PRT00709) | |||||
---|---|---|---|---|---|
Name | Urate anion exchanger 1 (URAT1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Renal-specific transporter; RST; Urate anion exchanger 1; Slc22a12; Urat1
|
||||
Gene Name | Slc22a12 | Gene ID | |||
UniProt ID | |||||
Family | Organic ion transporter (OIT) | ||||
TC Number | TC: 2.A.1.19.14 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAFPELLDRVGGLGRFQLFQTVALVTPILWVTTQNMLENFSAAVPHHRCWVPLLDNSTSQ
ASIPGDLGPDVLLAVSIPPGPDQQPHQCLRFRQPQWQLTESNATATNWSDAATEPCEDGW VYDHSTFRSTIVTTWDLVCNSQALRPMAQSIFLAGILVGAAVCGHASDRFGRRRVLTWSY LLVSVSGTAAAFMPTFPLYCLFRFLLASAVAGVMMNTASLLMEWTSAQGSPLVMTLNALG FSFGQVLTGSVAYGVRSWRMLQLAVSAPFFLFFVYSWWLPESARWLITVGKLDQGLQELQ RVAAVNRRKAEGDTLTMEVLRSAMEEEPSRDKAGASLGTLLHTPGLRHRTIISMLCWFAF GFTFYGLALDLQALGSNIFLLQALIGIVDFPVKTGSLLLISRLGRRFCQVSFLVLPGLCI LSNILVPHGMGVLRSALAVLGLGCLGGAFTCITIFSSELFPTVIRMTAVGLCQVAARGGA MLGPLVRLLGVYGSWMPLLVYGVVPVLSGLAALLLPETKNLPLPDTIQDIQKQSVKKVTH DTPDGSILMSTRL |
||||
Function | Required for efficient urate re-absorption in the kidney. Regulates blood urate levels. Mediates saturable urate uptake by facilitating the exchange of urate against organic anions or chloride ions. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organoheterocyclic compounds | ||||||
Uric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of Slc22a12 | |||||
Induced Change | Uric acid concentration: increase (FC = 1.50) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Adrenomedullary hyperfunction [ICD-11: 5A75] | |||||
Details | It is reported that overexpression of Slc22a12 leads to the increase of uric acid levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Molecular identification of a renal urate anion exchanger that regulates blood urate levels. Nature. 2002 May 23;417(6887):447-52. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.