Details of Protein
| General Information of Protein (ID: PRT00709) | |||||
|---|---|---|---|---|---|
| Name | Urate anion exchanger 1 (URAT1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Renal-specific transporter; RST; Urate anion exchanger 1; Slc22a12; Urat1
|
||||
| Gene Name | Slc22a12 | Gene ID | |||
| UniProt ID | |||||
| Family | Organic ion transporter (OIT) | ||||
| TC Number | TC: 2.A.1.19.14 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAFPELLDRVGGLGRFQLFQTVALVTPILWVTTQNMLENFSAAVPHHRCWVPLLDNSTSQ
ASIPGDLGPDVLLAVSIPPGPDQQPHQCLRFRQPQWQLTESNATATNWSDAATEPCEDGW VYDHSTFRSTIVTTWDLVCNSQALRPMAQSIFLAGILVGAAVCGHASDRFGRRRVLTWSY LLVSVSGTAAAFMPTFPLYCLFRFLLASAVAGVMMNTASLLMEWTSAQGSPLVMTLNALG FSFGQVLTGSVAYGVRSWRMLQLAVSAPFFLFFVYSWWLPESARWLITVGKLDQGLQELQ RVAAVNRRKAEGDTLTMEVLRSAMEEEPSRDKAGASLGTLLHTPGLRHRTIISMLCWFAF GFTFYGLALDLQALGSNIFLLQALIGIVDFPVKTGSLLLISRLGRRFCQVSFLVLPGLCI LSNILVPHGMGVLRSALAVLGLGCLGGAFTCITIFSSELFPTVIRMTAVGLCQVAARGGA MLGPLVRLLGVYGSWMPLLVYGVVPVLSGLAALLLPETKNLPLPDTIQDIQKQSVKKVTH DTPDGSILMSTRL |
||||
| Function | Required for efficient urate re-absorption in the kidney. Regulates blood urate levels. Mediates saturable urate uptake by facilitating the exchange of urate against organic anions or chloride ions. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organoheterocyclic compounds | ||||||
| Uric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Overexpression of Slc22a12 | |||||
| Induced Change | Uric acid concentration: increase (FC = 1.50) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Adrenomedullary hyperfunction [ICD-11: 5A75] | |||||
| Details | It is reported that overexpression of Slc22a12 leads to the increase of uric acid levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Molecular identification of a renal urate anion exchanger that regulates blood urate levels. Nature. 2002 May 23;417(6887):447-52. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

