Details of Protein

General Information of Protein (ID: PRT00703)
Name Solute carrier family 16 member 2 (SLC16A2)
Synonyms   Click to Show/Hide Synonyms of This Protein
MCT 8; Monocarboxylate transporter 7; MCT 7; Monocarboxylate transporter 8 ; X-linked PEST-containing transporter; SLC16A2; MCT8; XPCT
Gene Name SLC16A2 Gene ID
6567
UniProt ID
P36021
Family Monocarboxylate porter (MNP)
TC Number   TC: 2.A.1.13.10  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Monocarboxylate Transporter (MCT) Family
TC: 2.A.1.13.10
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPD
PAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNS
VGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAV
AFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSS
IFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLH
QRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLL
VCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFL
GLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAF
YFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
Function Very active and specific thyroid hormone transporter. Stimulates cellular uptake of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine. Does not transport Leu, Phe, Trp or Tyr.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Liothyronine Click to Show/Hide the Full List of Regulating Pair(s): 16 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC16A2
                      Induced Change Liothyronine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual ...
                      Details It is reported that overexpression of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Overexpression of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 4.4)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual ...
                      Details It is reported that overexpression of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (S290A) of SLC16A2
                      Induced Change Liothyronine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (S290A) of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (S290F) of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.85)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (S290F) of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (5) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (D453V+pCIneo-hD3) and overexpression of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.3)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (D453V+pCIneo-hD3) and overexpression of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (6) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (D453V+pCIneo-hD3) and overexpression of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.4)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (D453V+pCIneo-hD3) and overexpression of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (7) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (G221R) of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.2)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (G221R) of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (8) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (G282C) of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.7)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (G282C) of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (9) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (G282C+pCIneo-hD3) and overexpression of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.8)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (G282C+pCIneo-hD3) and overexpression of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (10) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (G558D) of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 2.3)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (G558D) of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (11) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (G558D+pCIneo-hD3) and overexpression of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 2.1)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (G558D+pCIneo-hD3) and overexpression of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (12) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (InsV236) of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.2)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (InsV236) of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (13) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (InsV236+pCIneo-hD3) and overexpression of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.5)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (InsV236+pCIneo-hD3) and overexpression of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (14) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (P321L) of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.3)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (P321L) of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (15) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (P537L) of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.5)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (P537L) of SLC16A2 leads to the increase of liothyronine levels compared with control group.
               Regulating Pair (16) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (P537L+pCIneo-hD3) and overexpression of SLC16A2
                      Induced Change Liothyronine concentration: increase (FC = 1.8)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (P537L+pCIneo-hD3) and overexpression of SLC16A2 leads to the increase of liothyronine levels compared with control group.
            Thyroxine Click to Show/Hide the Full List of Regulating Pair(s):   4 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (G558D) of SLC16A2
                      Induced Change Thyroxine concentration: increase (FC = 2.3)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (G558D) of SLC16A2 leads to the increase of thyroxine levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (S290A) of SLC16A2
                      Induced Change Thyroxine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (S290A) of SLC16A2 leads to the increase of thyroxine levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Mutation (S290F) of SLC16A2
                      Induced Change Thyroxine concentration: increase (FC = 1.74)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hypothyroidism [ICD-11: 5A00]
                      Details It is reported that mutation (S290F) of SLC16A2 leads to the increase of thyroxine levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC16A2
                      Induced Change Thyroxine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC16A2 leads to the increase of thyroxine levels compared with control group.
References
1 Transport of Iodothyronines by Human L-Type Amino Acid Transporters. Endocrinology. 2015 Nov;156(11):4345-55.
2 Mutations in MCT8 in patients with Allan-Herndon-Dudley-syndrome affecting its cellular distribution. Mol Endocrinol. 2013 May;27(5):801-13.
3 Further Insights into the Allan-Herndon-Dudley Syndrome: Clinical and Functional Characterization of a Novel MCT8 Mutation. PLoS One. 2015 Oct 1;10(10):e0139343.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.