Details of Protein

General Information of Protein (ID: PRT00701)
Name Glucose transporter type 14 (GLUT-14)
Synonyms   Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 14; GLUT-14; SLC2A14; GLUT14
Gene Name SLC2A14 Gene ID
144195
UniProt ID
Q8TDB8
Family Sugar transporter (ST)
TC Number   TC: 2.A.1.1.90  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Sugar Porter (SP) Family
TC: 2.A.1.1.90
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPET
IIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLI
VNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGT
LNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINR
KKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVL
QLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHM
IGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQG
PRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGR
TFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV
Function Hexose transporter that can mediate the transport of glucose and dehydroascorbate across the cell membrane.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic oxygen compounds
            Fructose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC2A14
                      Induced Change Fructose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that overexpression of SLC2A14 leads to the increase of fructose levels compared with control group.
      Organoheterocyclic compounds
            Dehydroascorbic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC2A14
                      Induced Change Dehydroascorbic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that overexpression of SLC2A14 leads to the increase of dehydroascorbic acid levels compared with control group.
References
1 The SLC2A14 gene, encoding the novel glucose/dehydroascorbate transporter GLUT14, is associated with inflammatory bowel disease. Am J Clin Nutr. 2017 Dec;106(6):1508-1513.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.