Details of Protein

General Information of Protein (ID: PRT00674)
Name Lysophosphatidate-3 receptor (LPAR3)
Synonyms   Click to Show/Hide Synonyms of This Protein
LPA receptor 3; LPA-3; Lysophosphatidic acid receptor Edg-7; LPAR3; EDG7; LPA3
Gene Name LPAR3 Gene ID
23566
UniProt ID
Q9UBY5
Family GPCR rhodopsin (GPCR-1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Function Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. May play a role in the development of ovarian cancer. Seems to be coupled to the G(i)/G(o) and G(q) families of heteromeric G proteins.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Lipids and lipid-like molecules
            LysoPA(18:1(9Z)/0:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation LysoPA(18:1(9Z)/0:0) addition (1 hours)
                      Induced Change LPAR3 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Motor neuron disease [ICD-11: 8B60]
                      Details It is reported that lysoPA(18:1(9Z)/0:0) addition causes the increase of LPAR3 protein expression compared with control group.
References
1 Molecular cloning and characterization of a novel human G-protein-coupled receptor, EDG7, for lysophosphatidic acid. J Biol Chem. 1999 Sep 24;274(39):27776-85.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.