Details of Protein

General Information of Protein (ID: PRT00673)
Name Histamine H3 receptor (HRH3)
Synonyms   Click to Show/Hide Synonyms of This Protein
H3R; HH3R; G-protein coupled receptor 97; HRH3; GPCR97
Gene Name HRH3 Gene ID
11255
UniProt ID
Q9Y5N1
Family GPCR rhodopsin (GPCR-1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Function The H3 subclass of histamine receptors could mediate the histamine signals in CNS and peripheral nervous system. Signals through the inhibition of adenylate cyclase and displays high constitutive activity (spontaneous activity in the absence of agonist). Agonist stimulation of isoform 3 neither modified adenylate cyclase activity nor induced intracellular calcium mobilization.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            L-Galactose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation L-Galactose addition (0.5 hour)
                      Induced Change HRH3 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Circadian rhythm sleep-wake disorders [ICD-11: 7A60]
                      Details It is reported that L-galactose addition causes the increase of HRH3 protein expression compared with control group.
References
1 Discovery and Development of N-[4-(1-Cyclobutylpiperidin-4-yloxy)phenyl]-2-(morpholin-4-yl)acetamide Dihydrochloride (SUVN-G3031): A Novel, Potent, Selective, and Orally Active Histamine H 3 Receptor Inverse Agonist with Robust Wake-Promoting Activity. J Med Chem. 2019 Feb 14;62(3):1203-1217.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.