Details of Protein

General Information of Protein (ID: PRT00667)
Name G-protein coupled receptor 55 (GPR55)
Synonyms   Click to Show/Hide Synonyms of This Protein
GPR55
Gene Name GPR55 Gene ID
9290
UniProt ID
Q9Y2T6
Family GPCR rhodopsin (GPCR-1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF
LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK
VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL
PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
AHRPSRVQLVLQDTTISRG
Function May be involved in hyperalgesia associated with inflammatory and neuropathic pain. Receptor for L-alpha-lysophosphatidylinositol (LPI). LPI induces Ca(2+) release from intracellular stores via the heterotrimeric G protein GNA13 and RHOA. Putative cannabinoid receptor. May play a role in bone physiology by regulating osteoclast number and function.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Lipids and lipid-like molecules
            1-Oleoyl LPI Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation 1-Oleoyl LPI addition (48 hours)
                      Induced Change GPR55 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that 1-oleoyl LPI addition causes the increase of GPR55 protein activity compared with control group.
            1-Palmitoyl LPI Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation 1-Palmitoyl LPI addition (48 hours)
                      Induced Change GPR55 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that 1-palmitoyl LPI addition causes the increase of GPR55 protein activity compared with control group.
            1-Stearoyl LPI Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation 1-Stearoyl LPI addition (48 hours)
                      Induced Change GPR55 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that 1-stearoyl LPI addition causes the increase of GPR55 protein activity compared with control group.
            2-Arachidonoyl-LPI Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation 2-Arachidonoyl-LPI addition (48 hours)
                      Induced Change GPR55 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that 2-arachidonoyl-LPI addition causes the increase of GPR55 protein activity compared with control group.
            2-Arachidonoylglycerolphosphoinositol Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation 2-Arachidonoylglycerolphosphoinositol addition (48 hours)
                      Induced Change GPR55 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that 2-arachidonoylglycerolphosphoinositol addition causes the increase of GPR55 protein activity compared with control group.
            2-Linoleoyl LPI Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation 2-Linoleoyl LPI addition (48 hours)
                      Induced Change GPR55 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that 2-linoleoyl LPI addition causes the increase of GPR55 protein activity compared with control group.
            2-Oleoyl LPI Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation 2-Oleoyl LPI addition (48 hours)
                      Induced Change GPR55 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that 2-oleoyl LPI addition causes the increase of GPR55 protein activity compared with control group.
            LysoPG(16:0/0:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation LysoPG(16:0/0:0) addition (48 hours)
                      Induced Change GPR55 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that lysoPG(16:0/0:0) addition causes the increase of GPR55 protein activity compared with control group.
References
1 2-Arachidonoyl-sn-glycero-3-phosphoinositol: a possible natural ligand for GPR55. J Biochem. 2009 Jan;145(1):13-20.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.