Details of Protein
| General Information of Protein (ID: PRT00647) | |||||
|---|---|---|---|---|---|
| Name | Kynurenic acid receptor (GPR35) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Kynurenic acid receptor; KYNA receptor; GPR35
|
||||
| Gene Name | GPR35 | Gene ID | |||
| UniProt ID | |||||
| Family | GPCR rhodopsin (GPCR-1) | ||||
| TC Number | TC: 9.A.14.13.8 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS QDSLCVTLA |
||||
| Function | Acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Lipids and lipid-like molecules | ||||||
| 2-Arachidonoyl-sn-glycero-3-phosphate(2-) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | 2-Arachidonoyl-sn-glycero-3-phosphate(2-) addition (2.7810^-4 hours) | |||||
| Induced Change | GPR35 protein activity levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Stomach cancer [ICD-11: 2B72] | |||||
| Details | It is reported that 2-arachidonoyl-sn-glycero-3-phosphate(2-) addition causes the increase of GPR35 protein activity compared with control group. | |||||
| 2-Linoleoyl LPA | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | 2-Linoleoyl LPA addition (2.7810^-4 hours) | |||||
| Induced Change | GPR35 protein activity levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Stomach cancer [ICD-11: 2B72] | |||||
| Details | It is reported that 2-linoleoyl LPA addition causes the increase of GPR35 protein activity compared with control group. | |||||
| 2-Oleoyl-LPA | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | 2-Oleoyl-LPA addition (2.7810^-4 hours) | |||||
| Induced Change | GPR35 protein activity levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Stomach cancer [ICD-11: 2B72] | |||||
| Details | It is reported that 2-oleoyl-LPA addition causes the increase of GPR35 protein activity compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | GPR35 is a novel lysophosphatidic acid receptor. Biochem Biophys Res Commun. 2010 Apr 30;395(2):232-7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.