Details of Protein

General Information of Protein (ID: PRT00628)
Name Excitatory amino acid transporter 2 (SLC1A2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Glutamate/aspartate transporter II; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2; SLC1A2; EAAT2; GLT1
Gene Name SLC1A2 Gene ID
6506
UniProt ID
P43004
Family Dicarboxylate/amino acid:cation symporter (DAACS)
TC Number   TC: 2.A.23.2.7  (Click to Show/Hide the Complete TC Tree)
The Dicarboxylate/Amino Acid:Cation (Na+ or H+) Symporter (DAACS) Family
.
TC: 2.A.23.2.7
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Function Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion. Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport. Essential for the rapid removal of released glutamate from the synaptic cleft, and for terminating the postsynaptic action of glutamate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            DL-Glutamate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC1A2
                      Induced Change DL-Glutamate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC1A2 leads to the increase of DL-Glutamate levels compared with control group.
            Glutamic acid Click to Show/Hide the Full List of Regulating Pair(s):   5 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Overexpression of SLC1A2
                      Induced Change Glutamic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC1A2 leads to the increase of glutamic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Inhibition (Dihydrokainic Acid (DHK)) of SLC1A2
                      Induced Change Glutamic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC1A2 leads to the decrease of glutamic acid levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Inhibition (DL-threo-beta-hydroxyaspartic acid (TBHA)) of SLC1A2
                      Induced Change Glutamic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC1A2 leads to the decrease of glutamic acid levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Inhibition (Kainic acid (KA)) of SLC1A2
                      Induced Change Glutamic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC1A2 leads to the decrease of glutamic acid levels compared with control group.
               Regulating Pair (5) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Inhibition (L-trans-pyrrolidine-2,4-dicar-boxylic acid (PDC)) of SLC1A2
                      Induced Change Glutamic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition of SLC1A2 leads to the decrease of glutamic acid levels compared with control group.
References
1 Caveolin-1 Sensitivity of Excitatory Amino Acid Transporters EAAT1, EAAT2, EAAT3, and EAAT4. J Membr Biol. 2016 Jun;249(3):239-49.
2 Excitatory amino acid transporter 5, a retinal glutamate transporter coupled to a chloride conductance. Proc Natl Acad Sci U S A. 1997 Apr 15;94(8):4155-60.
3 Functional comparisons of three glutamate transporter subtypes cloned from human motor cortex. J Neurosci. 1994 Sep;14(9):5559-69.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.