Details of Protein

General Information of Protein (ID: PRT00618)
Name N-system amino acid transporter 1 (NAT-1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Probable sodium-coupled neutral amino acid transporter 6; Na(+)-coupled neutral amino acid transporter 6; Solute carrier family 38 member 6; SLC38A6; NAT1; SNAT6
Gene Name SLC38A6 Gene ID
145389
UniProt ID
Q8IZM9
Family Amino acid/auxin permease (AAAP)
TC Number   TC: 2.A.18.6.11  (Click to Show/Hide the Complete TC Tree)
The Amino Acid/Auxin Permease (AAAP) Family
.
TC: 2.A.18.6.11
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEASWGSFNAERGWYVSVQQPEEAEAEELSPLLSNELHRQRSPGVSFGLSVFNLMNAIMG
SGILGLAYVLANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPG
KLVVAGTIIIQNIGAMSSYLLIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVF
PLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKP
KLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKRMQNVTNTAIALSFLIYFISA
LFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFPARKAVTMMFF
SNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSR
EDFLSWKKLGAFVLLIFGILVGNFSLALIIFDWINK
Function Probable sodium-dependent amino acid/proton antiporter, could be a neuronal transporter for glutamate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Glutamic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC38A6
                      Induced Change Glutamic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC38A6 leads to the increase of glutamic acid levels compared with control group.
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC38A6
                      Induced Change Glutamine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC38A6 leads to the increase of glutamine levels compared with control group.
References
1 Glutamine Uptake via SNAT6 and Caveolin Regulates Glutamine-Glutamate Cycle. Int J Mol Sci. 2021 Jan 25;22(3):1167.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.