Details of Protein
General Information of Protein (ID: PRT00584) | |||||
---|---|---|---|---|---|
Name | Sodium/glucose cotransporter 2 (SGLT2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Na(+)/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2; SLC5A2; SGLT2
|
||||
Gene Name | SLC5A2 | Gene ID | |||
UniProt ID | |||||
Family | Sodium:solute symporter (SSS) | ||||
TC Number | TC: 2.A.1.7.26 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM MAVAVFLWGFYA |
||||
Function | Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.; Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic oxygen compounds | ||||||
Methyl beta-D-glucopyranoside | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Inhibition (Phlorizin) of SLC5A2 | |||||
Induced Change | Methyl beta-D-glucopyranoside concentration: decrease (FC = 20) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
Details | It is reported that inhibition of SLC5A2 leads to the decrease of methyl beta-D-glucopyranoside levels compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of SLC5A2 | |||||
Induced Change | Methyl beta-D-glucopyranoside concentration: increase (FC = 3) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
Details | It is reported that overexpression of SLC5A2 leads to the increase of methyl beta-D-glucopyranoside levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Glucose transport by human renal Na+/D-glucose cotransporters SGLT1 and SGLT2. Am J Physiol Cell Physiol. 2011 Jan;300(1):C14-21. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.