Details of Protein

General Information of Protein (ID: PRT00576)
Name Solute carrier family 17 member 9 (SLC17A9)
Synonyms   Click to Show/Hide Synonyms of This Protein
Slc17a9
Gene Name Slc17a9 Gene ID
228993
UniProt ID
Q8VCL5
Family Sodium/anion cotransporter (SAC)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPSQRSSLMQPIPEETRKTPSAAAEDTRWSRPECQAWTGILLLGTCLLYCARVTMPVCTV
AMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGFITVTTPL
LAHLGSGHLAFLTFSRILTGLLQGVYFPALTSLLSQKVQESERAFTYSTVGAGSQVGTLV
TGGVGSVLLDQCGWQSVFYFSGGLTLLWAYYVYRYLLNEKDLVLALGFLAQGLPVTKPSK
VPWRQLFRKASVWAAICSQLCSACSFFILLSWLPTFFKETFPNSKGWVFNVVPWMLAIPA
SLFSGFISDRLISQGYRVITVRKFMQVMGLGLSSIFALCLGHTTSFLKAMIFASASIGFQ
TFNHSGISVNIQDLAPSCAGFLFGVANTAGALAGVVGVCLSGYLIETTGSWTCVFHLVAI
ISNLGLGTFLVFGKAQRVDLVPTHEDL
Function Involved in vesicular storage and exocytosis of ATP. May accumulate ATP and other nucleotides in secretory vesicles such as adrenal chromaffin granules and synaptic vesicles.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            ATP Click to Show/Hide the Full List of Regulating Pair(s):   3 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of Slc17a9
                      Induced Change ATP concentration: decrease (FC = 0.50)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Adrenomedullary hyperfunction [ICD-11: 5A75]
                      Details It is reported that knockdown of Slc17a9 leads to the decrease of ATP levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Knockdown (shRNA) of Slc17a9
                      Induced Change ATP concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of Slc17a9 leads to the decrease of ATP levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Overexpression of Slc17a9
                      Induced Change ATP concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Slc17a9 leads to the increase of ATP levels compared with control group.
References
1 Identification of a vesicular nucleotide transporter. Proc Natl Acad Sci U S A. 2008 Apr 15;105(15):5683-6.
2 SLC17A9 protein functions as a lysosomal ATP transporter and regulates cell viability. J Biol Chem. 2014 Aug 15;289(33):23189-23199.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.