Details of Protein
| General Information of Protein (ID: PRT00389) | |||||
|---|---|---|---|---|---|
| Name | Oxysterols receptor LXR-alpha (NR1H3) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Liver X receptor alpha; Nuclear receptor subfamily 1 group H member 3; Nr1h3; Lxra
|
||||
| Gene Name | Nr1h3 | Gene ID | |||
| UniProt ID | |||||
| Family | Nuclear hormone receptor (NHR) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MSLWLEASMPDVSPDSATELWKTEPQDAGDQGGNTCILREEARMPQSTGVALGIGLESAE
PTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFF RRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQ EEEQAQATSVSPRVSSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAP DPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLET SRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAI SIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLMFPRMLMKLVSLRTLSSVHS EQVFALRLQDKKLPPLLSEIWDVHE |
||||
| Structure | |||||
| Function | Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity. Interaction with retinoic acid receptor (RXR) shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES. LXRES are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides. Plays an important role in the regulation of cholesterol homeostasis, regulating cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8. Interplays functionally with RORA for the regulation of genes involved in liver metabolism. Induces LPCAT3-dependent phospholipid remodeling in endoplasmic reticulum (ER) membranes of hepatocytes, driving SREBF1 processing and lipogenesis. Via LPCAT3, triggers the incorporation of arachidonate into phosphatidylcholines of ER membranes, increasing membrane dynamics and enabling triacylglycerols transfer to nascent very low-density lipoprotein (VLDL) particles. Via LPCAT3 also counteracts lipid-induced ER stress response and inflammation, likely by modulating SRC kinase membrane compartmentalization and limiting the synthesis of lipid inflammatory mediators. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Lipids and lipid-like molecules | ||||||
| 24,25-Epoxy-cholesterol | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | 24,25-Epoxy-cholesterol addition (3 hours) | |||||
| Induced Change | NR1H3 protein activity levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Atherosclerosis [ICD-11: BD40] | |||||
| Details | It is reported that 24,25-epoxy-cholesterol addition causes the increase of NR1H3 protein activity compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Brain endogenous liver X receptor ligands selectively promote midbrain neurogenesis. Nat Chem Biol. 2013 Feb;9(2):126-33. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.