Details of Protein

General Information of Protein (ID: PRT00204)
Name Hydroperoxide isomerase ALOXE3 (eLOX-3)
Synonyms   Click to Show/Hide Synonyms of This Protein
Epidermis-type lipoxygenase 3; Epidermal LOX-3; e-LOX-3; eLOX-3; Hydroperoxy dehydratase ALOXE3; Hydroperoxy icosatetraenoate dehydratase; Hydroperoxy icosatetraenoate isomerase; Aloxe3
Gene Name Aloxe3 Gene ID
23801
UniProt ID
Q9WV07
Family Lyases (EC 4)
EC Number   EC: 4.2.1.152  (Click to Show/Hide the Complete EC Tree)
Lyases
Carbon-oxygen lyase
Hydro-lyase
EC: 4.2.1.152
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAVYRLCVTTGSYLKAGTLDNIYATLVGTCGESPKQKLDRVGRDFASGSVQKYKVRCEAE
LGEILLLRLHKERFAFFCKDPWYCSRICVTAPDGSAVHFPCYQWIDGYCTVELRPGTART
ICQDSLPLLLDHRKRELQARQECYRWKIFAPGFPRMVDVSSFQEMESDKKFALTKTVPCA
EQDDNSGNRYLPGFPMKIDIPSLLHMEPNIRYSATKTASLIFNALPASFGMKIRGLLDRK
GSWKRLDDIRNIFWCHKTFTSEYVTEHWCEDSFFGYQYLNGVNPVMLHCLSSLPSKLPVT
NDMVAPLLGPGTCLQTELERGHIFLADYWILAEAPVHCINGLQQYVTAPLCLLWLNPQGV
LLPLAIQLSQTPGPESPIFLPTDCELDWLLAKTWVRNSEFLVHENNTHFLCTHLLCEAFS
MATLRQLPLCHPVYKLLLPHTRYTLQVNTIARATLLNPDGLVDKVTSIGRQGLIYLMSTG
LAHFTYTDFCLPDSIRARGVLTIPNYHYRDDGLKIWAAIERFVSEIVSYYYPSDASVQQD
CELQAWVGEIFAQAFLGRESSGFPSRLCTPGELVKYLTAIIFNCSAQHAAVNSGQHDFGA
WMPNAPSSMRQPPPQTKGDTTMKSYLDTLPEVNTTCRNLLLFWLVSQEPKDQRPLGTYPD
EHFTEEAPRQSIAAFQNCLAQISKDIRERNQSLALPYAYLDPPLIENSVSI
Function Non-heme iron-containing lipoxygenase which is atypical in that it displays a prominent hydroperoxide isomerase activity and a reduced lipoxygenases activity. The hydroperoxide isomerase activity catalyzes the isomerization of hydroperoxides, derived from arachidonic and linoleic acid by ALOX12B, into hepoxilin-type epoxyalcohols and ketones. In presence of oxygen, oxygenates polyunsaturated fatty acids, including arachidonic acid, to produce fatty acid hydroperoxides. In the skin, acts downstream of ALOX12B on the linoleate moiety of esterified omega-hydroxyacyl-sphingosine (EOS) ceramides to produce an epoxy-ketone derivative, a crucial step in the conjugation of omega-hydroxyceramide to membrane proteins. Therefore plays a crucial role in the synthesis of corneocytes lipid envelope and the establishment of the skin barrier to water loss. In parallel, it may have a signaling function in barrier formation through the production of hepoxilins metabolites. Plays also a role in adipocyte differentiation through hepoxilin A3 and hepoxilin B3 production which in turn activate PPARG. Through the production of hepoxilins in the spinal cord, it may regulate inflammatory tactile allodynia.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            12-HETE Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Aloxe3
                      Induced Change 12-HETE concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Aloxe3 leads to the increase of 12-HETE levels compared with control group.
            Hepoxilin b3 Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Aloxe3
                      Induced Change Hepoxilin b3 concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Aloxe3 leads to the decrease of hepoxilin b3 levels compared with control group.
            Trioxilin A3 Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Aloxe3
                      Induced Change Trioxilin A3 concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Aloxe3 leads to the decrease of trioxilin A3 levels compared with control group.
References
1 Aloxe3 knockout mice reveal a function of epidermal lipoxygenase-3 as hepoxilin synthase and its pivotal role in barrier formation. J Invest Dermatol. 2013 Jan;133(1):172-80.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.