Details of Protein

General Information of Protein (ID: PRT00193)
Name Caspase-3 (CASP3)
Synonyms   Click to Show/Hide Synonyms of This Protein
CASP-3; Apopain; Cysteine protease CPP32; CPP-32; Protein Yama; SREBP cleavage activity 1; SCA-1; CASP3; CPP32
Gene Name CASP3 Gene ID
836
UniProt ID
P42574
Family Hydrolases (EC 3)
EC Number   EC: 3.4.22.56  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Peptidase
Cysteine protease
EC: 3.4.22.56
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Structure
1CP3 ; 1GFW ; 1I3O ; 1NME ; 1NMQ ; 1NMS ; 1PAU ; 1QX3 ; 1RE1 ; 1RHJ ; 1RHK ; 1RHM ; 1RHQ ; 1RHR ; 1RHU ; 2C1E ; 2C2K ; 2C2M ; 2C2O ; 2CDR ; 2CJX ; 2CJY ; 2CNK ; 2CNL ; 2CNN ; 2CNO ; 2DKO ; 2H5I ; 2H5J ; 2H65 ; 2J30 ; 2J31 ; 2J32 ; 2J33 ; 2XYG ; 2XYH ; 2XYP ; 2XZD ; 2XZT ; 2Y0B ; 3DEH ; 3DEI ; 3DEJ ; 3DEK ; 3EDQ ; 3GJQ ; 3GJR ; 3GJS ; 3GJT ; 3H0E ; 3ITN ; 3KJF ; 3PCX ; 3PD0 ; 3PD1 ; 4DCJ ; 4DCO ; 4DCP ; 4EHA ; 4EHD ; 4EHF ; 4EHH ; 4EHK ; 4EHL ; 4EHN ; 4JJE ; 4JQY ; 4JQZ ; 4JR0 ; 4PRY ; 4PS0 ; 4QTX ; 4QTY ; 4QU0 ; 4QU5 ; 4QU8 ; 4QU9 ; 4QUA ; 4QUB ; 4QUD ; 4QUE ; 4QUG ; 4QUH ; 4QUI ; 4QUJ ; 4QUL ; 5I9B ; 5I9T ; 5IAB ; 5IAE ; 5IAG ; 5IAJ ; 5IAK ; 5IAN ; 5IAR ; 5IAS ; 5IBC ; 5IBP ; 5IBR ; 5IC4
Function Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage. Cleaves and inhibits serine/threonine-protein kinase AKT1 in response to oxidative stress.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Arginine decrease (72 hours)
                      Induced Change CASP3 protein abundance levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Brain cancer [ICD-11: 2A00]
                      Details It is reported that arginine decrease causes the increase of CASP3 protein abundance compared with control group.
            Cysteine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Cysteine decrease (72 hours)
                      Induced Change CASP3 protein abundance levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Ovarian cancer [ICD-11: 2C73]
                      Details It is reported that cysteine decrease causes the increase of CASP3 protein abundance compared with control group.
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Glutamine addition (24 hours)
                      Induced Change CASP3 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that glutamine addition causes the decrease of CASP3 protein expression compared with control group.
References
1 Combinatory Treatment of Canavanine and Arginine Deprivation Efficiently Targets Human Glioblastoma Cells via Pleiotropic Mechanisms. Cells. 2020 Sep 30;9(10):2217.
2 Cysteine Deprivation Targets Ovarian Clear Cell Carcinoma Via Oxidative Stress and Iron-Sulfur Cluster Biogenesis Deficit. Antioxid Redox Signal. 2020 Dec 10;33(17):1191-1208.
3 Glutamine regulates the human epithelial intestinal HCT-8 cell proteome under apoptotic conditions. Mol Cell Proteomics. 2007 Oct;6(10):1671-9.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.