Details of Protein

General Information of Protein (ID: PRT00021)
Name Nucleosome-binding protein 45 (NBP-45)
Synonyms   Click to Show/Hide Synonyms of This Protein
Nucleosome-binding protein 1; High mobility group nucleosome-binding domain-containing protein 5; HMGN5; Protein GARP45; Hmgn5; Garp45; Nsbp1
Gene Name Hmgn5 Gene ID
50887
UniProt ID
Q9JL35
Family High mobility group N (HMGN)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPKRKAAGDVSQEPKRRSARLSAMPVPFTPELKPKRASTSRKTKTTNVVEENKDASTIPI
PETKPEDVKDECNMENAENGEAKIMEAPIPKMEAEEVKEQINEDTEEDGGEKKEAVAAEA
KDDELKANIQDVEKDEDGKEHKDTGEEVEDGKIEEEGLNEKPGTAKSEDAEVSKDEEEKG
DNEKGEDGKEEGDEKEEEKDDKEGDTGTEKEVKEQNKEAEEDDGKCKEEENKEVGKEGQP
EEDGKEDLHEEVGKEDLHEEDGKEGQPEEDGKEIHHEEDGKEGQPEEDGKEYLHEEDGEE
GQPKEDQKEGQPEEDGKEDQPEEDGKEGQCKEDGKEGHHEEGGKEDLHEEDGKEKDGGKE
DRKEEGEQEVAVDEGSDENKVEAEEEGAENKDFKQDGEKEEPLSIV
Function Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Betaine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Hmgn5
                      Induced Change Betaine concentration: decrease (FC = 0.48)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Hmgn5 leads to the decrease of betaine levels compared with control group.
            Creatine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Hmgn5
                      Induced Change Creatine concentration: decrease (FC = 0.58)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Hmgn5 leads to the decrease of creatine levels compared with control group.
            Oxidized glutathione Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Hmgn5
                      Induced Change Oxidized glutathione concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Hmgn5 leads to the increase of oxidized glutathione levels compared with control group.
            Phenylacetylglycine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Hmgn5
                      Induced Change Phenylacetylglycine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of Hmgn5 leads to the decrease of phenylacetylglycine levels compared with control group.
References
1 Metabolomics reveals a role for the chromatin-binding protein HMGN5 in glutathione metabolism. PLoS One. 2014 Jan 2;9(1):e84583.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.