Details of Protein

General Information of Protein (ID: PRT01690)
Name Dopamine D4 receptor (D4R)
Synonyms   Click to Show/Hide Synonyms of This Protein
D(2C) dopamine receptor; Dopamine D4 receptor
Gene Name Drd4 Gene ID
13491
UniProt ID
P51436
Family GPCR rhodopsin (GPCR-1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGNSSATEDGGLLAGRGPESLGTGAGLGGAGAAALVGGVLLIGLVLAGNSLVCVSVASER
TLQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI
FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVASPVVCGLNDVPGRDPAVC
CLENRDYVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV
SDPTQGPFFPDCPPPLPSLRTSPSDSSRPESELSQRPCSPGCLLADAALPQPPEPSSRRR
RGAKITGRERKAMRVLPVVVGAFLVCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN
SALNPIIYTIFNAEFRSVFRKTLRLRC
Structure
6IQL
Function Dopamine receptor responsible for neuronal signaling in the mesolimbic system of the brain, an area of the brain that regulates emotion and complex behavior. Activated by dopamine, but also by epinephrine and norepinephrine, and by numerous synthetic agonists and drugs. Agonist binding triggers signaling via G proteins that inhibit adenylyl cyclase (By similarity). Modulates the circadian rhythm of contrast sensitivity by regulating the rhythmic expression of NPAS2 in the retinal ganglion cells.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Benzenoids
            3,4-Dihydroxybenzeneacetic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Drd4
                      Induced Change 3,4-Dihydroxybenzeneacetic acid concentration: decrease (FC = 0.82)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of DRD4 leads to the decrease of 3,4-dihydroxybenzeneacetic acid levels compared with control group.
            Dopamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Drd4
                      Induced Change Dopamine concentration: decrease (FC = 0.28)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of DRD4 leads to the decrease of dopamine levels compared with control group.
            Homovanillic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Drd4
                      Induced Change Homovanillic acid concentration: decrease (FC = 0.60)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockout of DRD4 leads to the decrease of homovanillic acid levels compared with control group.
References
1 Dopamine D4 receptor knockout mice exhibit neurochemical changes consistent with decreased dopamine release. J Neurosci Methods. 2007 Nov 30;166(2):306-14.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.