Details of Protein
General Information of Protein (ID: PRT01688) | |||||
---|---|---|---|---|---|
Name | Mercaptopyruvate sulfurtransferase (MPST) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
3-Mercaptopyruvate sulfurtransferase; MST; TST2
|
||||
Gene Name | MPST | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.8.1.2 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFF
DIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAF GHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQV VDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDL SKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH |
||||
Structure | |||||
Function | Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. Detoxifies cyanide and is required for thiosulfate biosynthesis. Acts as an antioxidant. In combination with cysteine aminotransferase (CAT), contributes to the catabolism of cysteine and is an important producer of hydrogen sulfide in the brain, retina and vascular endothelial cells. Hydrogen sulfide H2S is an important synaptic modulator, signaling molecule, smooth muscle contractor and neuroprotectant. Its production by the 3MST/CAT pathway is regulated by calcium ions. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Lactic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockdown (siRNA) of MPST | |||||
Induced Change | Lactic acid concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockdown of Mpst leads to the increase of lactic acid levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | 3-Mercaptopyruvate sulfurtransferase disruption in dermal fibroblasts facilitates adipogenic trans-differentiation. Exp Cell Res. 2019 Dec 15;385(2):111683. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.