Details of Protein

General Information of Protein (ID: PRT01662)
Name Proteasome activator 28 alpha (PA28a)
Synonyms   Click to Show/Hide Synonyms of This Protein
11S regulator complex subunit alpha; REG-alpha; Activator of multicatalytic protease subunit 1; Proteasome activator 28 subunit alpha; PA28a; Proteasome activator complex subunit 1; PA28alpha; Psme1
Gene Name Psme1 Gene ID
19186
UniProt ID
P97371
Family Proteasome activator (PA)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MATLRVHPEAQAKVDVFREDLCSKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEEKEEKKKGDEDDKGPPCGPVNCNEKIVVLLQRLKPE
IKDVTEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTNLHTKLEGFHTQISKYFSE
RGDAVAKAAKQPHVGDYRQLVHELDEAEYQEIRLMVMEIRNAYAVLYDIILKNFEKLKKP
RGETKGMIY
Structure
5MSJ ; 5MX5
Function Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine addition (336 hours)
                      Induced Change PSME1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hyperhomocysteinaemia [ICD-11: 3B61]
                      Details It is reported that methionine addition causes the increase of PSME1 protein expression compared with control group.
References
1 The nutrigenetics of hyperhomocysteinemia: quantitative proteomics reveals differences in the methionine cycle enzymes of gene-induced versus diet-induced hyperhomocysteinemia. Mol Cell Proteomics. 2010 Mar;9(3):471-85.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.