Details of Protein
| General Information of Protein (ID: PRT01656) | |||||
|---|---|---|---|---|---|
| Name | Nuclear receptor coactivator 4 (RFG) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
NCoA-4; Androgen receptor coactivator 70 kDa protein; 70 kDa AR-activator; 70 kDa androgen receptor coactivator; Androgen receptor-associated protein of 70 kDa; Ret-activating protein ELE1; NCOA4; ARA70; ELE1; RFG
|
||||
| Gene Name | NCOA4 | Gene ID | |||
| UniProt ID | |||||
| Family | Nuclear coactivator (NCA) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSV CLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLE KRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTS SRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMD LSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEI ENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPS RIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWV LPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLK VDKEKWLYRTPLQM |
||||
| Structure | |||||
| Function | Enhances the androgen receptor transcriptional activity in prostate cancer cells. Ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Cysteine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Cysteine decrease (72 hours) | |||||
| Induced Change | NCOA4 protein abundance levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Ovarian cancer [ICD-11: 2C73] | |||||
| Details | It is reported that cysteine decrease causes the increase of NCOA4 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Cysteine Deprivation Targets Ovarian Clear Cell Carcinoma Via Oxidative Stress and Iron-Sulfur Cluster Biogenesis Deficit. Antioxid Redox Signal. 2020 Dec 10;33(17):1191-1208. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

