Details of Protein

General Information of Protein (ID: PRT01629)
Name Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2)
Synonyms   Click to Show/Hide Synonyms of This Protein
DDVit 1; Enterocyte differentiation-associated factor 1; EDAF-1; Enterocyte differentiation-promoting factor 1; EDPF-1; MMS2 homolog; Vitamin D3-inducible protein; UBE2V2; MMS2; UEV2
Gene Name UBE2V2 Gene ID
7336
UniProt ID
Q15819
Family Transferases (EC 2)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYEN
RIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQ
ELRRLMMSKENMKLPQPPEGQTYNN
Structure
1J74 ; 1J7D ; 1ZGU ; 3VON ; 4NR3 ; 4NRG ; 4NRI ; 4ONL ; 4ONM ; 4ONN ; 4ORH ; 5AIT
Function Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (12 hours)
                      Induced Change UBE2V2 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the decrease of UBE2V2 protein expression compared with control group.
References
1 Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.