Details of Protein
General Information of Protein (ID: PRT01589) | |||||
---|---|---|---|---|---|
Name | Pyruvate kinase 1 (PKLR) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Pyruvate kinase 1; Pyruvate kinase isozymes L/R; R-type/L-type pyruvate kinase; Red cell/liver pyruvate kinase; PKLR; PK1; PKL
|
||||
Gene Name | PKLR | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.7.1.40 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQ
LPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFS HGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKG SQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQV ENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA LGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRC NLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS AQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESG KLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS |
||||
Structure | |||||
Function | Plays a key role in glycolysis. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine decrease (48 hours) | |||||
Induced Change | PKLR protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
Details | It is reported that glutamine decrease causes the increase of PKLR protein expression compared with control group. | |||||
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glucose decrease (48 hours) | |||||
Induced Change | PKLR protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
Details | It is reported that glucose decrease causes the increase of PKLR protein expression compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[2] | ||||
Introduced Variation | Glucose addition (16 hours) | |||||
Induced Change | PKLR protein expression levels: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
Details | It is reported that glucose addition causes the decrease of PKLR protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.