Details of Protein

General Information of Protein (ID: PRT01579)
Name Phosphoserine aminotransferase (PSAT1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Phosphohydroxythreonine aminotransferase; PSAT; PSAT1; PSA
Gene Name PSAT1 Gene ID
29968
UniProt ID
Q9Y617
Family Transferases (EC 2)
EC Number   EC: 2.6.1.52  (Click to Show/Hide the Complete EC Tree)
Transferase
Transaminase
Transaminase
EC: 2.6.1.52
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLV
RELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGT
INIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSN
FLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLY
NTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSK
MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAF
MKKFLEMHQL
Structure
3E77
Function Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine decrease (48 hours)
                      Induced Change PSAT1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77] ...
                      Details It is reported that glutamine decrease causes the increase of PSAT1 protein expression compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine decrease (48 hours)
                      Induced Change PSAT1 mRNA levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77] ...
                      Details It is reported that glutamine decrease causes the increase of PSAT1 mRNA levels compared with control group.
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose decrease (48 hours)
                      Induced Change PSAT1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77] ...
                      Details It is reported that glucose decrease causes the increase of PSAT1 protein expression compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose decrease (48 hours)
                      Induced Change PSAT1 mRNA levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77] ...
                      Details It is reported that glucose decrease causes the increase of PSAT1 mRNA levels compared with control group.
      Phenylpropanoids and polyketides
            Tetracycline Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Tetracycline addition (72 hours)
                      Induced Change PSAT1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute lymphoblastic leukemia [ICD-11: 2B33]
                      Details It is reported that tetracycline addition causes the decrease of PSAT1 protein expression compared with control group.
References
1 cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Cell Res. 2015 Apr;25(4):429-44.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.