Details of Protein

General Information of Protein (ID: PRT01312)
Name CDK inhibitor 1B p27Kip1 (CDKN1B)
Synonyms   Click to Show/Hide Synonyms of This Protein
Cyclin-dependent kinase inhibitor p27; p27Kip1; CDKN1B; KIP1
Gene Name CDKN1B Gene ID
1027
UniProt ID
P46527
Family Cyclin-related protein (CRP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
Structure
1H27 ; 1JSU ; 2AST ; 5UQ3 ; 6ATH ; 6P8E ; 6P8F ; 6P8G
Function Important regulator of cell cycle progression. Inhibits the kinase activity of CDK2 bound to cyclin A, but has little inhibitory activity on CDK2 bound to SPDYA. Involved in G1 arrest. Potent inhibitor of cyclin E- and cyclin A-CDK2 complexes. Forms a complex with cyclin type D-CDK4 complexes and is involved in the assembly, stability, and modulation of CCND1-CDK4 complex activation. Acts either as an inhibitor or an activator of cyclin type D-CDK4 complexes depending on its phosphorylation state and/or stoichometry.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Phenylpropanoids and polyketides
            Tetracycline Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Tetracycline addition (12 hours)
                      Induced Change CDKN1B protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Acute lymphoblastic leukemia [ICD-11: 2B33]
                      Details It is reported that tetracycline addition causes the decrease of CDKN1B protein expression compared with control group.
References
1 cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Cell Res. 2015 Apr;25(4):429-44.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.