Details of Protein

General Information of Protein (ID: PRT01300)
Name Transforming protein RhoA (RHOA)
Synonyms   Click to Show/Hide Synonyms of This Protein
Rho cDNA clone 12; h12; RHOA; ARH12; ARHA; RHO12
Gene Name RHOA Gene ID
387
UniProt ID
P61586
Family Hydrolases (EC 3)
EC Number   EC: 3.6.5.2  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Acid anhydride hydrolase
GTP acid anhydride hydrolase
EC: 3.6.5.2
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
Structure
1A2B ; 1CC0 ; 1CXZ ; 1DPF ; 1FTN ; 1KMQ ; 1LB1 ; 1OW3 ; 1S1C ; 1TX4 ; 1X86 ; 1XCG ; 2RGN ; 3KZ1 ; 3LW8 ; 3LWN ; 3LXR ; 3MSX ; 3T06 ; 4D0N ; 4XH9 ; 4XOI ; 4XSG ; 4XSH ; 5A0F ; 5BWM ; 5C2K ; 5C4M ; 5EZ6 ; 5FR1 ; 5FR2 ; 5HPY ; 5IRC ; 5JCP ; 5JHG ; 5JHH ; 5M6X ; 5M70 ; 5ZHX ; 6BC0 ; 6BCA ; 6BCB ; 6KX2 ; 6KX3 ; 6R3V ; 6V6M ; 6V6U ; 6V6V
Function Small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Mainly associated with cytoskeleton organization, in active state binds to a variety of effector proteins to regulate cellular responses such as cytoskeletal dynamics, cell migration and cell cycle. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Regulates KCNA2 potassium channel activity by reducing its location at the cell surface in response to CHRM1 activation; promotes KCNA2 endocytosis. Acts as an allosteric activator of guanine nucleotide exchange factor ECT2 by binding in its activated GTP-bound form to the PH domain of ECT2 which stimulates the release of PH inhibition and promotes the binding of substrate RHOA to the ECT2 catalytic center. May be an activator of PLCE1. In neurons, involved in the inhibiton of the initial spine growth. Upon activation by CaMKII, modulates dendritic spine structural plasticity by relaying CaMKII transient activation to synapse-specific, long-term signaling. Acts as a regulator of platelet alpha-granule release during activation and aggregation of platelets.; (Microbial infection) Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Lipids and lipid-like molecules
            2-Oleoyl-LPA Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation 2-Oleoyl-LPA addition (0.25 hour)
                      Induced Change RHOA protein phosphorylation levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Stomach cancer [ICD-11: 2B72]
                      Details It is reported that 2-oleoyl-LPA addition causes the increase of RHOA protein phosphorylation compared with control group.
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change RHOA protein abundance levels: increase (FC = 1.32)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of RHOA protein abundance compared with control group.
References
1 GPR35 is a novel lysophosphatidic acid receptor. Biochem Biophys Res Commun. 2010 Apr 30;395(2):232-7.
2 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.