Details of Protein
General Information of Protein (ID: PRT01274) | |||||
---|---|---|---|---|---|
Name | Ras-related protein Rab-9A (RAB9A) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
RAB9A; RAB9
|
||||
Gene Name | RAB9A | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQI
WDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV ILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSD HLIQTDTVNLHRKPKPSSSCC |
||||
Structure | |||||
Function | Involved in the transport of proteins between the endosomes and the trans Golgi network. Involved in the recruitment of SGSM2 to melanosomes and is required for the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine decrease (120 hours) | |||||
Induced Change | RAB9A protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Stomach cancer [ICD-11: 2B72] | |||||
Details | It is reported that methionine decrease causes the increase of RAB9A protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Applying proteomic methodologies to analyze the effect of methionine restriction on proliferation of human gastric cancer SGC7901 cells. Clin Chim Acta. 2007 Feb;377(1-2):206-12. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.