Details of Protein

General Information of Protein (ID: PRT01163)
Name Glucose transporter type 5 (GLUT-5)
Synonyms   Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 5; Fructose transporter; Glucose transporter type 5, small intestine; GLUT-5; SLC2A5; GLUT5
Gene Name SLC2A5 Gene ID
6518
UniProt ID
P22732
Family Sugar transporter (ST)
TC Number   TC: 2.A.1.1.13  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Sugar Porter (SP) Family
TC: 2.A.1.1.13
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE
FMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSR
VATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIF
GLRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGW
DSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYA
DQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFSICLIACCVLT
AALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNK
VSEVYPEKEELKELPPVTSEQ
Structure
1YG1
Function Functions as a fructose transporter that has only low activity with other monosaccharides. Can mediate the uptake of 2-deoxyglucose, but with low efficiency. Essential for fructose uptake in the small intestine. Plays a role in the regulation of salt uptake and blood pressure in response to dietary fructose. Required for the development of high blood pressure in response to high dietary fructose intake.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic oxygen compounds
            Fructose Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC2A5
                      Induced Change Fructose concentration: increase (FC = 8 - 9)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC2A5 leads to the increase of fructose levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (I296V) of SLC2A5
                      Induced Change Fructose concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (I296V) of SLC2A5 leads to the decrease of fructose levels compared with control group.
References
1 Reassessment of GLUT7 and GLUT9 as Putative Fructose and Glucose Transporters. J Membr Biol. 2017 Apr;250(2):171-182.
2 Identification of a hydrophobic residue as a key determinant of fructose transport by the facilitative hexose transporter SLC2A7 (GLUT7). J Biol Chem. 2005 Dec 30;280(52):42978-83.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.