Details of Protein

General Information of Protein (ID: PRT01159)
Name Arachidonate 15-lipoxygenase B (ALOX15B)
Synonyms   Click to Show/Hide Synonyms of This Protein
15-lipoxygenase 2; 15-LOX-2; Polyunsaturated fatty acid lipoxygenase ALOX15B; 15-LOX-B; Arachidonate 15-lipoxygenase type II; Linoleate 13-lipoxygenase 15-LOb; Alox15b
Gene Name Alox15b Gene ID
266604
UniProt ID
Q8K4F2
Family Oxidoreductases (EC 1)
EC Number   EC: 1.13.11.33  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen single donor oxidoreductase
Oxygen single donor oxidoreductase
EC: 1.13.11.33
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAKFRVRVSTGEACGAGTWDKVSVSIVGTHGESPLVPLDHLGKEFSAGAEEDFEVTLPQD
VGTVLMLRIHKAPPEAPLPLLSFPPDAWYCRWFELEWLPGAALRFPCYQWLEGAGELVLR
EGAAKVSWQDHHRTLQDQRQKELESRKDMYSWKTYIEGWPHCLDHETVKDLDLNIKYSAM
KNAKFFFKAQSAFTELKFKGLLDRTGLWRSLREMKRMFNFHNTPAAEYVFAHWQEDAFFA
SQFLNGLNPVLIRRCRRLPENFPVTDEMVAPVLGPGTSLQAELEKGSLFLVDHGILSGVQ
TNVINGKPQFSAAPMTLLYQSPGSGPLLPIAIQLKQTPGPDNPIFLPSDDKWDWLLAKTW
VRNAEFSIHEALTHLLHAHLIPEVFALATLRQLPHCHPLFKLLIPHTRYTLHINTLAREL
LIAPGKVVDKSTGLGIGGFSDLIKRNMEQLSYSVLCLPEDIRARDVGDLPGYYYRDDGMQ
IWSAIRSFVSEIVDIYYPSDASVRDDQELQAWVGEIFSEGFLSQESSGMPSLLDTQEALV
QYVTMVIFTCSAKHAAVSASQFDSCVWMPNLPPSMQLPPPTSKGQASPEGFIATLPAVNA
TCDVIIALWLLSKEPGDRRPLGHYPDEHFTEEVPRRSIAAFQRKLIQISSGIRKRNQSLA
LPYTYLDPPLIENSVSI
Function Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids (PUFAs) generating a spectrum of bioactive lipid mediators. Inserts a peroxyl group at C15 of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) producing (15S)-hydroperoxyeicosatetraenoate/(15S)-HPETE. Also peroxidizes linoleate ((9Z,12Z)-octadecadienoate) to 13-hydroperoxyoctadecadienoate/13-HPODE. Oxygenates arachidonyl derivatives such as 2-arachidonoylglycerol (2-AG) leading to the production and extracellular release of 15-hydroxyeicosatetraenoyl glycerol (15-HETE-G) that acts as a peroxisome proliferator-activated receptor alpha agonist.Has the ability to efficiently class-switch ALOX5 pro-inflammatory mediators into anti-inflammatory intermediates. Participates in the sequential oxidations of DHA ((4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate) to generate specialized pro-resolving mediators (SPMs) resolvin D5 ((7S,17S)-diHPDHA), which can actively downregulate the immune response and have anti-aggregation properties with platelets. In addition to free PUFAs hydrolyzed from phospholipids, it directly oxidizes PUFAs esterified to membrane-bound phospholipids. Has no detectable 8S-lipoxygenase activity on arachidonate but reacts with (8S)-HPETE to produce (8S,15S)-diHPETE. May regulate progression through the cell cycle and cell proliferation. May also regulate cytokine secretion by macrophages and therefore play a role in the immune response. May also regulate macrophage differentiation into proatherogenic foam cells.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            12-HETE Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Alox15b
                      Induced Change 12-HETE concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Alox15b leads to the increase of 12-HETE levels compared with control group.
            15-HETE Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Alox15b
                      Induced Change 15-HETE concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Alox15b leads to the increase of 15-HETE levels compared with control group.
            Troxilin B3 Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of Alox15b
                      Induced Change Troxilin B3 concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of Alox15b leads to the increase of troxilin B3 levels compared with control group.
References
1 Systematic analysis of rat 12/15-lipoxygenase enzymes reveals critical role for spinal eLOX3 hepoxilin synthase activity in inflammatory hyperalgesia. FASEB J. 2013 May;27(5):1939-49.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.