Details of Protein

General Information of Protein (ID: PRT01069)
Name Solute carrier family 27 member 5 (SLC27A5)
Synonyms   Click to Show/Hide Synonyms of This Protein
BACS; Bile acid-CoA ligase; BA-CoA ligase; BAL; Cholate--CoA ligase; Fatty acid transport protein 5; FATP-5; Solute carrier family 27 member 5; Very long-chain acyl-CoA synthetase-related protein; VLACS-related; VLACSR; Slc27a5; Acsb; Acsvl6; Fatp5; Vlacsr
Gene Name Slc27a5 Gene ID
26459
UniProt ID
Q4LDG0
Family Fatty acid transporter (FAT)
EC Number   EC: 6.2.1.7  (Click to Show/Hide the Complete EC Tree)
Ligase
Carbon-sulfur ligase
Acid-thiol ligase
EC: 6.2.1.7
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGIWKKLTLLLLLLLLVGLGQPPWPAAMALALRWFLGDPTCLVLLGLALLGRPWISSWMP
HWLSLVGAALTLFLLPLQPPPGLRWLHKDVAFTFKMLFYGLKFRRRLNKHPPETFVDALE
RQALAWPDRVALVCTGSEGSSITNSQLDARSCQAAWVLKAKLKDAVIQNTRDAAAILVLP
SKTISALSVFLGLAKLGCPVAWINPHSRGMPLLHSVRSSGASVLIVDPDLQENLEEVLPK
LLAENIHCFYLGHSSPTPGVEALGASLDAAPSDPVPASLRATIKWKSPAIFIFTSGTTGL
PKPAILSHERVIQVSNVLSFCGCRADDVVYDVLPLYHTIGLVLGFLGCLQVGATCVLAPK
FSASRFWAECRQHGVTVILYVGEILRYLCNVPEQPEDKIHTVRLAMGNGLRANVWKNFQQ
RFGPIRIWEFYGSTEGNVGLMNYVGHCGAVGRTSCILRMLTPFELVQFDIETAEPLRDKQ
GFCIPVEPGKPGLLLTKVRKNQPFLGYRGSQAESNRKLVANVRRVGDLYFNTGDVLTLDQ
EGFFYFQDRLGDTFRWKGENVSTGEVECVLSSLDFLEEVNVYGVPVPGCEGKVGMAAVKL
APGKTFDGQKLYQHVRSWLPAYATPHFIRIQDSLEITNTYKLVKSRLVREGFDVGIIADP
LYILDNKAQTFRSLMPDVYQAVCEGTWNL
Function Acyl-CoA synthetase that catalyzes the activation of bile acids via formation of bile acid CoA thioesters which is necessary for their subsequent conjugation with glycine or taurine. Catalyzes the activation of the primary bile acid, cholic acid. Both primary bile acid (chenodeoxycholic acid) and secondary bile acids (deoxycholic acid and lithocholic acid) are the principal substrates. Also exhibits acyl CoA synthetase activity that activates very long-chain fatty acids (VLCFAs) by catalyzing the formation of fatty acyl-CoA. In vitro, also activates 3-alpha,7-alpha,12-alpha-trihydroxy-5- beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Exhibits long-chain fatty acids (LCFA) transport activity. Plays an important role in hepatic fatty acid uptake and bile acid reconjugation and recycling but not in de novo synthesis of bile acids.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            Cholic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of Slc27a5
                      Induced Change Cholic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of Slc27a5 leads to the decrease of cholic acid levels compared with control group.
            Taurocholic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of Slc27a5
                      Induced Change Taurocholic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of Slc27a5 leads to the decrease of taurocholic acid levels compared with control group.
References
1 Attenuation of Slc27a5 gene expression followed by LC-MS measurement of bile acid reconjugation using metabolomics and a stable isotope tracer strategy. J Proteome Res. 2011 Oct 7;10(10):4683-91.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.