Details of Protein

General Information of Protein (ID: PRT01017)
Name Beta-galactosyltransferase 5 (B4GALT5)
Synonyms   Click to Show/Hide Synonyms of This Protein
Beta-1,4-GalTase 5; Beta4Gal-T5; b4Gal-T5; Beta-1,4-GalT II; Glucosylceramide beta-1,4-galactosyltransferase; Lactosylceramide synthase; LacCer synthase; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5; B4galt5; Bgt-5
Gene Name B4galt5 Gene ID
56336
UniProt ID
Q9JMK0
Family Transferases (EC 2)
EC Number   EC: 2.4.1.274  (Click to Show/Hide the Complete EC Tree)
Transferase
Glycosyltransferase
Hexosyltransferase
EC: 2.4.1.274
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMVQAQGILLRDNVRTI
GAQVYEQVVRSAYAKRNSSLNDSDYPLDLNHSEAFPPTTTFLPEDFTYFANHPCPERLPS
MKGPIDINMSEIAMDDIHELFSRDPAIKLGGHWKPADCVPRWKVAILIPFRNRHEHLPVL
LRHLLPMLQRQRLQFAFYVIEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPE
SDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGED
DDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN
YSANVTYDALYKNITVNLTPELAQVTEY
Function Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphingolipids) which play pivotal roles in the CNS including neuronal maturation and axonal and myelin formation. Plays a role in the glycosylation of BMPR1A and regulation of its protein stability. Essential for extraembryonic development during early embryogenesis.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipid-related molecules
            LacCer(d18:1/12:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of B4galt5
                      Induced Change LacCer(d18:1/12:0) concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of B4galt5 leads to the decrease of LacCer(d18:1/12:0) levels compared with control group.
      Lipids and lipid-like molecules
            Ceramide(d20:1/18:0) Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of B4galt5
                      Induced Change Ceramide(d20:1/18:0) concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of B4galt5 leads to the decrease of ceramide(d20:1/18:0) levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of B4galt5
                      Induced Change Ceramide(d20:1/18:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of B4galt5 leads to the increase of ceramide(d20:1/18:0) levels compared with control group.
            GlcCer(d18:1/22:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of B4galt5
                      Induced Change GlcCer(d18:1/22:0) concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of B4galt5 leads to the increase of glcCer(d18:1/22:0) levels compared with control group.
References
1 Adipocytes harbor a glucosylceramide biosynthesis pathway involved in iNKT cell activation. Biochim Biophys Acta Mol Cell Biol Lipids. 2019 Aug;1864(8):1157-1167.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.