Details of Protein
General Information of Protein (ID: PRT01010) | |||||
---|---|---|---|---|---|
Name | Sodium-independent sulfate anion transporter (SLC26A11) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Solute carrier family 26 member 11; SLC26A11
|
||||
Gene Name | SLC26A11 | Gene ID | |||
UniProt ID | |||||
Family | Sulfate permease (SULP) | ||||
TC Number | TC: 2.A.53.1.10 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MPSSVTALGQARSSGPGMAPSACCCSPAALQRRLPILAWLPSYSLQWLKMDFVAGLSVGL
TAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEP AYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIP RPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLV WAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPV TGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFD TKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSLLMLLHSAARPETKVSEGPV LVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQ KQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK VALLKA |
||||
Function | Exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC). | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Homogeneous non-metal compounds | ||||||
Sulfate | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Inhibition (4,4'-diisothiocyanostilbene-2,2'-disulfonic acid (DIDS)) of SLC26A11 | |||||
Induced Change | Sulfate concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that inhibition of SLC26A11 leads to the decrease of sulfate levels compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of SLC26A11 | |||||
Induced Change | Sulfate concentration: increase (FC = 3) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that overexpression of SLC26A11 leads to the increase of sulfate levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Molecular and functional characterization of SLC26A11, a sodium-independent sulfate transporter from high endothelial venules. FASEB J. 2003 May;17(8):890-2. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.