Details of Protein
| General Information of Protein (ID: PRT01002) | |||||
|---|---|---|---|---|---|
| Name | Heme oxygenase 1 (HMOX1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
HO-1; HMOX1; HO; HO1
|
||||
| Gene Name | HMOX1 | Gene ID | |||
| UniProt ID | |||||
| Family | Oxidoreductases (EC 1) | ||||
| EC Number | EC: 1.14.14.18 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM |
||||
| Structure | |||||
| Function | Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine addition (6 hours) | |||||
| Induced Change | HMOX1 mRNA levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
| Details | It is reported that glutamine addition causes the increase of HMOX1 mRNA levels compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine addition (6 hours) | |||||
| Induced Change | HMOX1 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
| Details | It is reported that glutamine addition causes the increase of HMOX1 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Acute enteral glutamine infusion enhances heme oxygenase-1 expression in human duodenal mucosa. J Nutr. 2002 Sep;132(9):2570-3. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

