Details of Protein

General Information of Protein (ID: PRT01002)
Name Heme oxygenase 1 (HMOX1)
Synonyms   Click to Show/Hide Synonyms of This Protein
HO-1; HMOX1; HO; HO1
Gene Name HMOX1 Gene ID
3162
UniProt ID
P09601
Family Oxidoreductases (EC 1)
EC Number   EC: 1.14.14.18  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.18
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
Structure
1N3U ; 1N45 ; 1NI6 ; 1OYK ; 1OYL ; 1OZE ; 1OZL ; 1OZR ; 1OZW ; 1S13 ; 1S8C ; 1T5P ; 1TWN ; 1TWR ; 1XJZ ; 1XK0 ; 1XK1 ; 1XK2 ; 1XK3 ; 3CZY ; 3HOK ; 3K4F ; 3TGM ; 4WD4 ; 5BTQ ; 6EHA
Function Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (6 hours)
                      Induced Change HMOX1 mRNA levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the increase of HMOX1 mRNA levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (6 hours)
                      Induced Change HMOX1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the increase of HMOX1 protein expression compared with control group.
References
1 Acute enteral glutamine infusion enhances heme oxygenase-1 expression in human duodenal mucosa. J Nutr. 2002 Sep;132(9):2570-3.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.