Details of Protein
General Information of Protein (ID: PRT00982) | |||||
---|---|---|---|---|---|
Name | Glucose transporter type 10 (GLUT-10) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 10; SLC2A10; GLUT10
|
||||
Gene Name | SLC2A10 | Gene ID | |||
UniProt ID | |||||
Family | Sugar transporter (ST) | ||||
TC Number | TC: 2.A.1.1.59 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL
ASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACC IYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSL SLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRGRTTVGLGLVL FQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALL LAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPIPRTN EDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFL LYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAA S |
||||
Function | Facilitative glucose transporter required for the development of the cardiovascular system. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Lipids and lipid-like molecules | ||||||
2-Deoxyglucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of SLC2A10 | |||||
Induced Change | 2-Deoxyglucose concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
Details | It is reported that overexpression of SLC2A10 leads to the increase of 2-deoxyglucose levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Sequence and functional analysis of GLUT10: a glucose transporter in the Type 2 diabetes-linked region of chromosome 20q12-13.1. Mol Genet Metab. Sep-Oct 2001;74(1-2):186-99. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.