Details of Protein
| General Information of Protein (ID: PRT00982) | |||||
|---|---|---|---|---|---|
| Name | Glucose transporter type 10 (GLUT-10) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 10; SLC2A10; GLUT10
|
||||
| Gene Name | SLC2A10 | Gene ID | |||
| UniProt ID | |||||
| Family | Sugar transporter (ST) | ||||
| TC Number | TC: 2.A.1.1.59 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL
ASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACC IYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSL SLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRGRTTVGLGLVL FQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALL LAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPIPRTN EDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFL LYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAA S |
||||
| Function | Facilitative glucose transporter required for the development of the cardiovascular system. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Lipids and lipid-like molecules | ||||||
| 2-Deoxyglucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Overexpression of SLC2A10 | |||||
| Induced Change | 2-Deoxyglucose concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
| Details | It is reported that overexpression of SLC2A10 leads to the increase of 2-deoxyglucose levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Sequence and functional analysis of GLUT10: a glucose transporter in the Type 2 diabetes-linked region of chromosome 20q12-13.1. Mol Genet Metab. Sep-Oct 2001;74(1-2):186-99. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

