Details of Protein

General Information of Protein (ID: PRT00931)
Name Solute carrier family 26 member 1 (SLC26A1)
Synonyms   Click to Show/Hide Synonyms of This Protein
SAT-1; Sulfate anion transporter 1; SLC26A1; SAT1
Gene Name SLC26A1 Gene ID
10861
UniProt ID
Q9H2B4
Family Sulfate permease (SULP)
TC Number   TC: 2.A.53.2.16  (Click to Show/Hide the Complete TC Tree)
The Sulfate Permease (SulP) Family
.
TC: 2.A.53.2.16
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLQPGANSSTLNGSAAMLDCGRDCYAIRV
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GPGMVVLTWLSLLRGAGQANVCDVVTSTVCLAVLLAAKELSDRYRHRLRVPLPTELLVIV
VATLVSHFGQLHKRFGSSVAGDIPTGFMPPQVPEPRLMQRVALDAVALALVAAAFSISLA
EMFARSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CMLVSTEAGLLAGVILSLLSLAGRTQRPRTALLARIGDTAFYEDATEFEGLVPEPGVRVF
RFGGPLYYANKDFFLQSLYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRA
ALVPAAAGFHTVVIDCAPLLFLDAAGVSTLQDLRRDYGALGISLLLACCSPPVRDILSRG
GFLGEGPGDTAEEEQLFLSVHDAVQTARARHRELEATDAHL
Function Mediates sulfate transport with high affinity. Mediates oxalate transport. Mediates bicarbonate transport. Does not accept succinate as cosubstrate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Homogeneous non-metal compounds
            Chloride ion Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC26A1
                      Induced Change Chloride ion concentration: increase (FC = 5)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC26A1 leads to the increase of chloride ion levels compared with control group.
            Sulfate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC26A1
                      Induced Change Sulfate concentration: increase (FC = 40)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC26A1 leads to the increase of sulfate levels compared with control group.
      Organic acids and derivatives
            Oxalic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC26A1
                      Induced Change Oxalic acid concentration: increase (FC = 6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC26A1 leads to the increase of oxalic acid levels compared with control group.
References
1 Characterization of the human sulfate anion transporter (hsat-1) protein and gene (SAT1; SLC26A1). DNA Cell Biol. 2003 Feb;22(2):107-17.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.