Details of Protein
| General Information of Protein (ID: PRT00918) | |||||
|---|---|---|---|---|---|
| Name | Extracellular sulfatase Sulf-1 (SULF1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
mSulf-1; Sulf1; Kiaa1077
|
||||
| Gene Name | Sulf1 | Gene ID | |||
| UniProt ID | |||||
| Family | Hydrolases (EC 3) | ||||
| EC Number | EC: 3.1.6.- (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MKYSLWALLLAVLGTQLLGSLCSTVRSQRFRGRIQQERKNIRPNIILVLTDDQDVELGSL
QVMNKTRKIMEQGGATFTNAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNENCSSPSWQAM HEPRTFAVYLNNTGYRTAFFGKYLNEYNGSYIPPGWREWLGLIKNSRFYNYTVCRNGIKE KHGFDYAKDYFTDLITNESINYFKMSKRMYPHRPIMMVISHAAPHGPEDSAPQFSKLYPN ASQHITPSYNYAPNMDKHWIMQYTGPMLPIHMEFTNVLQRKRLQTLMSVDDSVERLYNML VESGELDNTYIIYTADHGYHIGQFGLVKGKSMPYDFDIRVPFFIRGPSIEPGSIVPQIVL NIDLAPTILDIAGLDSPSDVDGKSVLKLLDLEKPGNRFRTNKKAKIWRDTFLVERGKFLR KKEESGKNIQQSNHLPKYERVKELCQQARYQTACEQPGQNWQCIEDTSGKLRIHKCKGPS DLLTVRQNARNLYSRGLHDKDKECHCRDSGYRSSRSQRKNQRQFLRNKGTPKYKPRFVHT RQTRSLSVEFEGEIYDINLEEEELQVLPPRSIAKRHDEGHQGFIGHQAAAGDIRNEMLAD SNNAVGLPATVRVTHKCFILPNDTIHCERELYQSARAWKDHKAYIDKEIEVLQDKIKNLR EVRGHLKKRKPEECGCGDQSYYNKEKGVKRQEKLKSHLHPFKEAAAQEVDSKLQLFKEHR RRKKERKEKKRQRKGEECSLPGLTCFTHDNNHWQTAPFWNLGSFCACTSSNNNTYWCLRT VNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERSILNQLHIQLMELRSCQGYKQC NPRPKSLDIGAKEGGNYDPHRGQLWDGWEG |
||||
| Function | Exhibits arylsulfatase activity and highly specific endoglucosamine-6-sulfatase activity. It can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin. Diminishes HSPG (heparan sulfate proteoglycans) sulfation, inhibits signaling by heparin-dependent growth factors, diminishes proliferation, and facilitates apoptosis in response to exogenous stimulation. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Nucleosides, nucleotides, and analogues | ||||||
| ATP | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Sulf1 | |||||
| Induced Change | ATP concentration: increase (FC = 1.37) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Ovarian cancer [ICD-11: 2C73] | |||||
| Details | It is reported that knockout of Sulf1 leads to the increase of ATP levels compared with control group. | |||||
| Organic acids and derivatives | ||||||
| Lactic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Sulf1 | |||||
| Induced Change | Lactic acid concentration: increase (FC = 1.22) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Ovarian cancer [ICD-11: 2C73] | |||||
| Details | It is reported that knockout of Sulf1 leads to the increase of lactic acid levels compared with control group. | |||||
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Sulf1 | |||||
| Induced Change | Glucose concentration: increase (FC = 1.84) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Ovarian cancer [ICD-11: 2C73] | |||||
| Details | It is reported that knockout of Sulf1 leads to the increase of glucose levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | HSulf-1 deficiency dictates a metabolic reprograming of glycolysis and TCA cycle in ovarian cancer. Oncotarget. 2015 Oct 20;6(32):33705-19. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

