Details of Protein
General Information of Protein (ID: PRT00905) | |||||
---|---|---|---|---|---|
Name | Protein disulfide-isomerase A3 (PDIA3) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
58 kDa glucose-regulated protein; 58 kDa microsomal protein; p58; Disulfide isomerase ER-60; Endoplasmic reticulum resident protein 57; ER protein 57; ERp57; Endoplasmic reticulum resident protein 60; ER protein 60; ERp60; Pdia3; Erp; Erp60; Grp58
|
||||
Gene Name | Pdia3 | Gene ID | |||
UniProt ID | |||||
Family | Isomerases (EC 5) | ||||
EC Number | EC: 5.3.4.1 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MRFSCLALLPGVALLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRD NYRFAHTNIESLVKEYDDNGEGITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSI FGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA VASRKTFSHELSDFGLESTTGEVPVVAIRTAKGEKFVMQEEFSRDGKALEQFLQEYFDGN LKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELG EKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYL QREATNPPIIQEEKPKKKKKAQEDL |
||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Leucine decrease (2 hours) | |||||
Induced Change | PDIA3 protein phosphorylation levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that leucine decrease causes the increase of PDIA3 protein phosphorylation compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Phospho-proteomic approach to identify new targets of leucine deprivation in muscle cells. Anal Biochem. 2008 Oct 1;381(1):148-50. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.