Details of Protein

General Information of Protein (ID: PRT00887)
Name PPAR-gamma (PPARG)
Synonyms   Click to Show/Hide Synonyms of This Protein
PPAR-gamma; Nuclear receptor subfamily 1 group C member 3; PPARG; NR1C3
Gene Name PPARG Gene ID
5468
UniProt ID
P37231
Family Nuclear hormone receptor (NHR)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Structure
1FM6 ; 1FM9 ; 1I7I ; 1K74 ; 1KNU ; 1NYX ; 1PRG ; 1RDT ; 1WM0 ; 1ZEO ; 1ZGY ; 2ATH ; 2F4B ; 2FVJ ; 2G0G ; 2G0H ; 2GTK ; 2HFP ; 2HWQ ; 2HWR ; 2I4J ; 2I4P ; 2I4Z ; 2OM9 ; 2P4Y ; 2POB ; 2PRG ; 2Q59 ; 2Q5P ; 2Q5S ; 2Q61 ; 2Q6R ; 2Q6S ; 2Q8S ; 2QMV ; 2VSR ; 2VST ; 2VV0 ; 2VV1 ; 2VV2 ; 2VV3 ; 2VV4 ; 2XKW ; 2YFE ; 2ZK0 ; 2ZK1 ; 2ZK2 ; 2ZK3 ; 2ZK4 ; 2ZK5 ; 2ZK6 ; 2ZNO ; 2ZVT ; 3ADS ; 3ADT ; 3ADU ; 3ADV ; 3ADW ; 3ADX ; 3AN3 ; 3AN4 ; 3B0Q ; 3B0R ; 3B1M ; 3B3K ; 3BC5 ; 3CDP ; 3CDS ; 3CS8 ; 3CWD ; 3D6D ; 3DZU ; 3DZY ; 3E00 ; 3ET0 ; 3ET3 ; 3FEJ ; 3FUR ; 3G9E ; 3GBK ; 3H0A ; 3HO0 ; 3HOD ; 3IA6 ; 3K8S ; 3KMG ; 3LMP ; 3NOA ; 3OSI ; 3OSW ; 3PBA ; 3PO9 ; 3PRG ; 3QT0 ; 3R5N ; 3R8A ; 3R8I ; 3S9S ; 3SZ1 ; 3T03 ; 3TY0 ; 3U9Q ; 3V9T ; 3V9V ; 3V9Y ; 3VJH ; 3VJI ; 3VN2 ; 3VSO ; 3VSP ; 3WJ4 ; 3WJ5 ; 3WMH ; 3X1H ; 3X1I ; 4A4V ; 4A4W ; 4CI5 ; 4E4K ; 4E4Q ; 4EM9 ; 4EMA ; 4F9M ; 4FGY ; 4HEE ; 4JAZ ; 4JL4 ; 4L96 ; 4L98 ; 4O8F ; 4OJ4 ; 4PRG ; 4PVU ; 4PWL ; 4R06 ; 4R2U ; 4R6S ; 4XLD ; 4XTA ; 4XUH ; 4XUM ; 4Y29 ; 4YT1 ; 5AZV ; 5DSH ; 5DV3 ; 5DV6 ; 5DV8 ; 5DVC ; 5DWL ; 5F9B ; 5GTN ; 5GTO ; 5GTP ; 5HZC ; 5JI0 ; 5LSG ; 5TTO ; 5TWO ; 5U5L ; 5UGM ; 5WQX ; 5WR0 ; 5WR1 ; 5Y2O ; 5Y2T ; 5YCN ; 5YCP ; 5Z5S ; 5Z6S ; 6AD9 ; 6AN1 ; 6AUG ; 6AVI ; 6C1I ; 6C5Q ; 6C5T ; 6D3E ; 6D8X ; 6D94 ; 6DBH ; 6DCU ; 6DGL ; 6DGO ; 6DGP ; 6DGQ ; 6DGR ; 6DH9 ; 6DHA ; 6E5A ; 6ENQ ; 6F2L ; 6FZF ; 6FZG ; 6FZJ ; 6FZP ; 6FZY ; 6ICJ ; 6IJR ; 6IJS ; 6ILQ ; 6IZM ; 6IZN ; 6JEY ; 6JF0 ; 6JQ7 ; 6K0T ; 6KTM ; 6KTN ; 6L89 ; 6L8B ; 6MCZ ; 6MD0 ; 6MD1 ; 6MD2 ; 6MD4 ; 6MS7 ; 6O67 ; 6O68 ; 6ONI ; 6ONJ ; 6PDZ ; 6QJ5 ; 6T6B ; 6T9C ; 6TDC ; 6TSG ; 6Y3U ; 6ZLY ; 7AHJ ; 7AWC ; 7AWD
Function Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proinflammatory responses. Plays a role in the regulation of cardiovascular circadian rhythms by regulating the transcription of ARNTL/BMAL1 in the blood vessels.; (Microbial infection) Upon treatment with M.tuberculosis or its lipoprotein LpqH, phosphorylation of MAPK p38 and IL-6 production are modulated, probably via this protein.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipids and lipid-like molecules
            2-Deoxyglucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Agonist (apo-12'-lycopenal) of PPARG
                      Induced Change 2-Deoxyglucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that agonist of PPARG leads to the increase of 2-deoxyglucose levels compared with control group.
            TG(10:0/10:0/10:0) Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Agonist (apo-12'-lycopenal) of PPARG
                      Induced Change TG(10:0/10:0/10:0) concentration: increase (FC = 1.6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that agonist of PPARG leads to the increase of TG(10:0/10:0/10:0) levels compared with control group.
References
1 Apo-12'-lycopenal, a Lycopene Metabolite, Promotes Adipocyte Differentiation via Peroxisome Proliferator-Activated Receptor Activation. J Agric Food Chem. 2018 Dec 19;66(50):13152-13161.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.