Details of Protein

General Information of Protein (ID: PRT00883)
Name Glucose-6-phosphate translocase (SLC37A4)
Synonyms   Click to Show/Hide Synonyms of This Protein
Glucose-5-phosphate transporter; Glucose-6-phosphate translocase; Solute carrier family 37 member 4; Transformation-related gene 19 protein; TRG-19; PRO0685; TRG19; SLC37A4; G6PT; G6PT1
Gene Name SLC37A4 Gene ID
2542
UniProt ID
O43826
Family Organophosphate:Pi antiporter (OPA)
TC Number   TC: 2.A.1.4.5  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Organophosphate:Pi Antiporter (OPA) Family
TC: 2.A.1.4.5
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAY
AISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPP
CGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCVVVS
FLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVK
TCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPR
HGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPN
LCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTK
MGRVSKKAE
Function Inorganic phosphate and glucose-6-phosphate antiporter of the endoplasmic reticulum. Transports cytoplasmic glucose-6-phosphate into the lumen of the endoplasmic reticulum and translocates inorganic phosphate into the opposite direction. Forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic oxygen compounds
            Glucose 6-phosphate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC37A4
                      Induced Change Glucose 6-phosphate concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC37A4 leads to the increase of glucose 6-phosphate levels compared with control group.
References
1 SLC37A1 and SLC37A2 are phosphate-linked, glucose-6-phosphate antiporters. PLoS One. 2011;6(9):e23157.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.