Details of Protein

General Information of Protein (ID: PRT00860)
Name Fatty acid-binding protein 4 (FABP4)
Synonyms   Click to Show/Hide Synonyms of This Protein
Adipocyte lipid-binding protein; ALBP; Adipocyte-type fatty acid-binding protein; A-FABP; AFABP; Fatty acid-binding protein 4; FABP4
Gene Name FABP4 Gene ID
2167
UniProt ID
P15090
Family Fatty acid binding protein (FABP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Structure
1TOU ; 1TOW ; 2HNX ; 2NNQ ; 3FR2 ; 3FR4 ; 3FR5 ; 3P6C ; 3P6D ; 3P6E ; 3P6F ; 3P6G ; 3P6H ; 3Q6L ; 3RZY ; 4NNS ; 4NNT ; 5D45 ; 5D47 ; 5D48 ; 5D4A ; 5EDB ; 5EDC ; 5HZ6 ; 5HZ8 ; 5Y0F ; 5Y0G ; 5Y0X ; 5Y12 ; 5Y13 ; 6AYL ; 6LJS ; 6LJT ; 6LJU ; 6LJV ; 6LJW ; 6LJX
Function Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organoheterocyclic compounds
            5-Hydroxymethylcytosine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of FABP4
                      Induced Change 5-Hydroxymethylcytosine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Ovarian cancer [ICD-11: 2C73]
                      Details It is reported that knockdown of FABP4 leads to the increase of 5-hydroxymethylcytosine levels compared with control group.
References
1 Adipocyte-Induced FABP4 Expression in Ovarian Cancer Cells Promotes Metastasis and Mediates Carboplatin Resistance. Cancer Res. 2020 Apr 15;80(8):1748-1761.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.