Details of Protein

General Information of Protein (ID: PRT00856)
Name Mitochondrial uncoupling protein 3 (UCP3)
Synonyms   Click to Show/Hide Synonyms of This Protein
UCP 3; Solute carrier family 25 member 9; Ucp3; Slc25a9
Gene Name Ucp3 Gene ID
22229
UniProt ID
P56501
Family Mitochondrial carrier (MC)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MVGLQPSEVPPTTVVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGAQSVQYRGVLG
TILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGADHSSVAIRILAG
CTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWP
NITRNAIVNCAEMVTYDIIKEKLLESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTR
YMNAPLGRYRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRALMKV
QVLRESPF
Function UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Leucine addition (1.50 hours)
                      Induced Change UCP3 mRNA levels: increase (FC = 1.51)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that leucine addition causes the increase of UCP3 mRNA levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Leucine addition (1.50 hours)
                      Induced Change UCP3 protein expression levels: increase (FC = 0.01227)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that leucine addition causes the increase of UCP3 protein expression compared with control group.
References
1 Increasing dietary leucine intake reduces diet-induced obesity and improves glucose and cholesterol metabolism in mice via multimechanisms. Diabetes. 2007 Jun;56(6):1647-54.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.