Details of Protein

General Information of Protein (ID: PRT00853)
Name Solute carrier family 25 member 23 (SLC25A23)
Synonyms   Click to Show/Hide Synonyms of This Protein
Mitochondrial ATP-Mg/Pi carrier protein 2; Mitochondrial Ca(2+)-dependent solute carrier protein 2; Small calcium-binding mitochondrial carrier protein 3; Calcium-binding mitochondrial carrier protein SCaMC-3; SLC25A23; APC2; MCSC2; SCAMC3
Gene Name SLC25A23 Gene ID
79085
UniProt ID
Q9BV35
Family Mitochondrial carrier (MC)
TC Number   TC: 2.A.29.23.5  (Click to Show/Hide the Complete TC Tree)
The Mitochondrial Carrier (MC) Family
.
TC: 2.A.29.23.5
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA
DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEK
LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRS
LWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM
EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLK
NWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQASIEGGPQLSMLG
LLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR
Function Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Acts as a regulator of mitochondrial calcium uptake via interaction with MCU and MICU1.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Homogeneous metal compounds
            Calcium Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of SLC25A23
                      Induced Change Calcium concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cervical Cancer [ICD-11: 2C77]
                      Details It is reported that knockdown of SLC25A23 leads to the decrease of calcium levels compared with control group.
References
1 SLC25A23 augments mitochondrial Ca2+ uptake, interacts with MCU, and induces oxidative stress-mediated cell death. Mol Biol Cell. 2014 Mar;25(6):936-47.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.