Details of Protein
| General Information of Protein (ID: PRT00844) | |||||
|---|---|---|---|---|---|
| Name | Pyruvate carrier 2 (MPC2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Brain protein 44; Mpc2; Brp44
|
||||
| Gene Name | Mpc2 | Gene ID | |||
| UniProt ID | |||||
| Family | Mitochondrial pyruvate carrier (MPC) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAAAGARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM
ARPAEKLSTAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWRYNQE LKSKGIQ |
||||
| Function | Mediates the uptake of pyruvate into mitochondria. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Pyruvic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Overexpression of Mpc2 | |||||
| Induced Change | Pyruvic acid concentration: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that overexpression of Mpc2 leads to the increase of pyruvic acid levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | A role for the mitochondrial pyruvate carrier as a repressor of the Warburg effect and colon cancer cell growth. Mol Cell. 2014 Nov 6;56(3):400-13. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.