Details of Protein
General Information of Protein (ID: PRT00844) | |||||
---|---|---|---|---|---|
Name | Pyruvate carrier 2 (MPC2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Brain protein 44; Mpc2; Brp44
|
||||
Gene Name | Mpc2 | Gene ID | |||
UniProt ID | |||||
Family | Mitochondrial pyruvate carrier (MPC) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAAAGARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM
ARPAEKLSTAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWRYNQE LKSKGIQ |
||||
Function | Mediates the uptake of pyruvate into mitochondria. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Pyruvic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of Mpc2 | |||||
Induced Change | Pyruvic acid concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Colon cancer [ICD-11: 2B90] | |||||
Details | It is reported that overexpression of Mpc2 leads to the increase of pyruvic acid levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | A role for the mitochondrial pyruvate carrier as a repressor of the Warburg effect and colon cancer cell growth. Mol Cell. 2014 Nov 6;56(3):400-13. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.