Details of Protein

General Information of Protein (ID: PRT00810)
Name Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
Synonyms   Click to Show/Hide Synonyms of This Protein
GAPDH; Peptidyl-cysteine S-nitrosylase GAPDH; Gapdh; Gapd
Gene Name Gapdh Gene ID
14433
UniProt ID
P16858
Family Oxidoreductases (EC 1)
EC Number   EC: 1.2.1.12  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Aldehyde/oxo donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.2.1.12
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKA
ENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIIS
APSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAIT
ATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSV
VDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIA
LNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE
Structure
6LGJ ; 6LGK ; 6LGM
Function Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules. Also participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            ATP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of Gapdh
                      Induced Change ATP concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of Gapdh leads to the decrease of ATP levels compared with control group.
      Organic acids and derivatives
            Glutathione Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (siRNA) of Gapdh
                      Induced Change Glutathione concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that knockdown of Gapdh leads to the decrease of glutathione levels compared with control group.
References
1 Glucose metabolism during in vitro maturation of mouse oocytes: An study using RNA interference. J Cell Physiol. 2018 Sep;233(9):6952-6964.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.