Details of Protein
General Information of Protein (ID: PRT00809) | |||||
---|---|---|---|---|---|
Name | Serotonin receptor 4 (HTR4) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
5-HT 4 receptor; 5-HT-4; 5-HT4; Serotonin receptor 4; HTR4
|
||||
Gene Name | HTR4 | Gene ID | |||
UniProt ID | |||||
Family | GPCR rhodopsin (GPCR-1) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD AVECGGQWESQCHPPATSPLVAAQPSDT |
||||
Structure | |||||
Function | This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organoheterocyclic compounds | ||||||
Serotonin | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Serotonin addition (1 hours) | |||||
Induced Change | HTR4 protein activity levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Dyspepsia [ICD-11: DD90] | |||||
Details | It is reported that serotonin addition causes the increase of HTR4 protein activity compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | The 5-HT4 receptor agonist, tegaserod, is a potent 5-HT2B receptor antagonist in vitro and in vivo. Br J Pharmacol. 2004 Nov;143(5):549-60. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.