Details of Protein

General Information of Protein (ID: PRT00794)
Name T-cell surface glycoprotein CD3 zeta chain (CD247)
Synonyms   Click to Show/Hide Synonyms of This Protein
T-cell receptor T3 zeta chain; CD antigen CD247; CD247; CD3Z; T3Z; TCRZ
Gene Name CD247 Gene ID
919
UniProt ID
P20963
Family Signaling adaptor protein (SAP)
TC Number   TC: 8.A.128.7.1  (Click to Show/Hide the Complete TC Tree)
The Signaling Adaptor Protein KARAP/DAP12/TYROBP (SAP) Family
.
TC: 8.A.128.7.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSAD
APAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA
EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Structure
1TCE ; 1YGR ; 2HAC ; 2OQ1 ; 3IK5 ; 3IOZ ; 4XZ1 ; 6JXR
Function Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN).
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Arginine decrease (24 hours)
                      Induced Change CD247 mRNAlevel levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Sepsis [ICD-11: 1G40]
                      Details It is reported that arginine decrease causes the decrease of CD247 mRNA levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Arginine decrease (48 hours)
                      Induced Change CD247 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Sepsis [ICD-11: 1G40]
                      Details It is reported that arginine decrease causes the decrease of CD247 protein expression compared with control group.
References
1 Regulation of T cell receptor CD3zeta chain expression by L-arginine. J Biol Chem. 2002 Jun 14;277(24):21123-9.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.