Details of Protein
General Information of Protein (ID: PRT00723) | |||||
---|---|---|---|---|---|
Name | Solute carrier SLC15A2 (PEPT2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Kidney H(+)/peptide cotransporter; Oligopeptide transporter, kidney isoform; Peptide transporter 2; SLC15A2; PEPT2
|
||||
Gene Name | SLC15A2 | Gene ID | |||
UniProt ID | |||||
Family | Proton-dependent oligopeptide transporter (POT/PTR) | ||||
TC Number | TC: 2.A.17.4.8 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSY
YGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLV YVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEER TRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSK IYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALT RVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPLLVLIFIPLFD FVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHS VQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVG EDYGVSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIED IPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIV LVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVKTEDMRGPADKHIPHIQGNMI KLETKKTKL |
||||
Structure | |||||
Function | Proton-coupled amino-acid transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. Transports the dipeptide-like aminopeptidase inhibitor bestatin. Can also transport the aminocephalosporin antibiotic cefadroxil. Also able to transport carnosine. Involved in innate immunity by promoting the detection of microbial pathogens by NOD-like receptors (NLRs). Probably acts by mediating transport of bacterial peptidoglycans across the plasma membrane: catalyzes the transport of certain bacterial peptidoglycans, such as muramyl dipeptide (MDP), the NOD2 ligand. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Carnosine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockdown (siRNA) of SLC15A2 | |||||
Induced Change | Carnosine concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Brain cancer [ICD-11: 2A00] | |||||
Details | It is reported that knockdown of SLC15A2 leads to the decrease of carnosine levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | The proton-coupled oligopeptide transporters PEPT2, PHT1 and PHT2 mediate the uptake of carnosine in glioblastoma cells. Amino Acids. 2019 Jul;51(7):999-1008. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.