Details of Protein

General Information of Protein (ID: PRT00717)
Name Solute carrier family 23 member 1 (SLC23A1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Na(+)/L-ascorbic acid transporter 1; Sodium-dependent vitamin C transporter 1; hSVCT1; Yolk sac permease-like molecule 3; SLC23A1; SVCT1; YSPL3
Gene Name SLC23A1 Gene ID
9963
UniProt ID
Q9UHI7
Family Nucleobase/ascorbate transporter (NAT)
TC Number   TC: 2.A.40.6.5  (Click to Show/Hide the Complete TC Tree)
The Nucleobase/Ascorbate Transporter (NAT) or Nucleobase:Cation Symporter-2 (NCS2) Family
.
TC: 2.A.40.6.5
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MRAQEDLEGRTQHETTRDPSTPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTI
AVPFLLAEALCVGHDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKA
ILALERWKCPPEEEIYGNWSLPLNTSHIWHPRIREVQGAIMVSSVVEVVIGLLGLPGALL
NYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISACSILLIILFSQYLRNLTFLLPVYRW
GKGLTLLRIQIFKMFPIMLAIMTVWLLCYVLTLTDVLPTDPKAYGFQARTDARGDIMAIA
PWIRIPYPCQWGLPTVTAAAVLGMFSATLAGIIESIGDYYACARLAGAPPPPVHAINRGI
FTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAAIMLVLGTIGKFTALF
SSLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLESNPG
AINTGILEVDQILIVLLTTEMFVGGCLAFILDNTVPGSPEERGLIQWKAGAHANSDMSSS
LKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETASVCTKV
Function Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organoheterocyclic compounds
            Ascorbic acid Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC23A1
                      Induced Change Ascorbic acid concentration: increase (FC = 15)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC23A1 leads to the increase of ascorbic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Mutation (His51Ala) of SLC23A1
                      Induced Change Ascorbic acid concentration: increase (FC = 6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (His51Ala) of SLC23A1 leads to the increase of ascorbic acid levels compared with control group.
References
1 Human vitamin C (L-ascorbic acid) transporter SVCT1. Biochem Biophys Res Commun. 2000 Jan 19;267(2):488-94.
2 Functional role of conserved transmembrane segment 1 residues in human sodium-dependent vitamin C transporters. Biochemistry. 2008 Mar 4;47(9):2952-60.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.